KEGG   Rattus norvegicus (rat): 499314
Entry
499314            CDS       T01003                                 

Gene name
Tut1
Definition
(RefSeq) terminal uridylyl transferase 1, U6 snRNA-specific
  KO
K18709  speckle targeted PIP5K1A-regulated poly(A) polymerase [EC:2.7.7.19 2.7.7.52]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     499314 (Tut1)
    2.7.7.52  RNA uridylyltransferase
     499314 (Tut1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Poly(A) addition factors
     499314 (Tut1)
SSDB
Motif
Pfam: TUTase RRM_1 zf-met PAP_assoc zf-C2H2_jaz RL RRM_7 zf-C2H2_2
Other DBs
NCBI-GeneID: 499314
NCBI-ProteinID: NP_001029073
RGD: 1561043
Ensembl: ENSRNOG00000020047
UniProt: Q3MHT4
Position
1q43
AA seq 866 aa
MAAVDSDVVSLPRGRFRCCLCDVTTANRPSLDAHLKGRKHRDLVQLRATRKAQGLRSVFV
SGFPRDVGSAQLSEYFQTFGPVANIVMDKDKGVFAIVEMGDISAREAVLSQPKHSLGGHT
LRVRPREQKEFQSPASKSPKGVDSNSHQLAQALAEAADVGAQMVKLVELRELSEAERQLR
TLVVALMQEVFTEFFPGCVVHPFGSSVNSFDVHGCDLDLFLDLGDMEEPQPDPQTPKLPE
ASSLDSTLASSLDPQVLACTPASLDSLSPTSLQDSEALDFETPSSLAPQTPDSALGSDTV
TSPQSLPPVSPLEEDRGEGKHRKELELAEASKDEKEEATAVLELVGSILRGCVPGVYRVQ
TVPSARRPVVKFCHRPSGLHGDISLSNRLALYNSRFLNLCSEMDSRVRPLVYTLRCWAQH
NGLSGGGPLLNNYALTLLVIYFLQTRDPPVLPTVAQLTQRSGEGEQVEVDGWDCSFPKDA
SRLEPSTNVEPLSSLLAQFFSCVSCWDLSGSLLSLREGQALMVAGGLPSDLWEGLRLGPM
NLQDPFDLSHNVAANVTSRVAKRLQSSCGAAASYCRSLQYQQRSSRGRDWGLLPLLQPSS
PSSLLSAKLIPLPSAPFPQIITALVSVLREALGCHIEQGTKRRRSEGARSKDSPLGGANK
RPRLSGQEKSCEEGKEEPQGCAGDHSENEVEEMVIELRETPQDWALLHCGPPGELPLMTA
KCLDKTAEQNPMEPEGAGEGSPGETEKEASHPSSVSWRCALWHQIWQGRRRARRRFQQQT
KEEGRGGPSTGAEWLAVEARVTQELKGPKSEQQRLQGEPLLTFVASASQAEQTLTVAPLQ
DPQGLFPGLHHFLQVFIPQALKNLLK
NT seq 2601 nt   +upstreamnt  +downstreamnt
atggcggcggtggattcggatgttgtatcgctgccgcgtggccgctttcgctgctgcctc
tgcgatgttactacagccaaccgacccagcctagatgcccacttgaaaggccggaagcac
cgggatctggtacaactacgagctaccagaaaggcccagggacttcgaagtgtgtttgtc
agtggctttcccagggatgtaggctctgctcagctctctgaatacttccagacatttggc
cctgtggccaatattgttatggacaaggacaagggggtgtttgccatcgtggagatggga
gacataagtgctcgggaggctgtcttatctcagcccaagcacagccttgggggacacaca
ctgcgtgtccggccaagggagcagaaggagttccagagcccagcttccaagtctcccaaa
ggagtggactcaaatagtcaccagctggcccaagcactggctgaggccgcagatgtaggg
gcacagatggtgaagcttgtggaactgagggagttgtctgaggctgagcggcagcttcgg
acccttgttgtggccctgatgcaggaggtcttcacagagttctttcctggctgtgtggtc
catccttttggctcttctgtcaatagctttgatgttcatggctgtgatctcgacctcttc
ttggacttgggagatatggaagagccccagccagacccacagactccaaagcttccagag
gcttcgtccttggactcaacccttgcttcttccctggatcctcaagtgctggcctgcacc
ccagcttctctagactcactgtctccaacatctctccaagattctgaagccctggacttt
gaaaccccttcttctctggcaccacagaccccagactctgctttgggctctgacactgtc
acctctccccagtccctgcctccagtttccccactggaggaggacaggggagaggggaaa
cacaggaaggagctagaattagcagaagcctcaaaggacgagaaggaggaggcaacagca
gtgttagagctggtgggatctattctccgtggctgtgtccctggagtgtaccgagtccaa
actgtgccctctgccaggcgtcctgtggtcaagttctgtcatcggccttcaggtcttcat
ggagacatctccctcagtaaccggttggccttgtataattcccgcttcctgaacctatgc
tctgagatggatagtcgagtccggccccttgtgtataccttacgctgctgggctcagcat
aatgggctgtcagggggcggcccccttctcaataactacgccttgacgttgttagtgatc
tacttccttcagaccagagaccctccagtgcttcctactgtggcccagcttacgcagaga
tcaggtgaaggggagcaggtagaagttgatggctgggactgtagcttccctaaggatgcc
tcaagactggagcccagcaccaacgtagagcctctcagttccctgctggcccagttcttc
tcctgcgtgtcttgctgggatctttctggctccctgctgtccctgcgggaaggtcaggca
ctgatggtggcagggggcctgccttctgatctctgggaagggctgcgccttggccccatg
aatctccaggacccctttgatctgagtcacaatgttgcagccaatgtgaccagccgcgtg
gctaagcgtctgcagagcagttgtggagcagcagctagttactgccggagtctccagtac
cagcagcgctcctcccggggccgggactggggactgctcccacttttgcagcccagctcc
cctagctccctgctctctgccaagcttatccccttaccctctgccccctttccacagatc
attacagctttggtgagtgtgttaagggaagcactaggatgccatatagaacagggaacc
aagagacgacggtcggaaggtgccagatctaaagactctcccctgggaggggcaaacaaa
agaccaagacttagtgggcaagaaaagagctgtgaggaagggaaagaggagccacaggga
tgtgcaggggaccacagtgaaaatgaggtagaagaaatggtaatagaattgcgagagaca
cctcaggactgggccttgttgcactgtggaccaccaggggagttgcccctgatgactgca
aaatgtctagacaagactgctgagcagaatcccatggaacctgagggggctggagaaggg
tcccccggtgagacagagaaggaggcttcacacccgtcatcagtgagttggcgctgtgcc
ttgtggcaccaaatatggcaggggaggcggcgtgcccggagacgatttcagcagcaaacc
aaggaagaaggcagaggaggtcccagcaccggagcagagtggctggcagtggaagcacga
gtaacccaggaactgaagggaccaaagagtgagcagcagaggctacagggggagcccctc
ctcacctttgtggcatcggcctcccaagctgagcagacactcactgtggcacccctccag
gatccccaaggcctgttccctggtcttcatcattttctacaggtttttatccctcaagca
cttaaaaatctcctcaagtga

DBGET integrated database retrieval system