KEGG   Rattus norvegicus (rat): 499330
Entry
499330            CDS       T01003                                 

Gene name
Nmrk1, Nrk1
Definition
(RefSeq) nicotinamide riboside kinase 1
  KO
K10524  nicotinamide/nicotinate riboside kinase [EC:2.7.1.22 2.7.1.173]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00760  Nicotinate and nicotinamide metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    499330 (Nmrk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     499330 (Nmrk1)
    2.7.1.173  nicotinate riboside kinase
     499330 (Nmrk1)
SSDB
Motif
Pfam: AAA_18 AAA_33 DUF5805
Other DBs
NCBI-GeneID: 499330
NCBI-ProteinID: NP_001019463
RGD: 1564687
Ensembl: ENSRNOG00000012665
UniProt: Q6AY91
Position
1q43
AA seq 195 aa
MKTFVIGIGGVTNGGKTTLAKNLQKRLPNCSVISQDDFFKPESEIDIDENGFLQYDVLEA
LNMEKMMSAVSCWMENPGSSAGPAALESAQGVPILIIEGFLLFNYKPLDTIWNRSYFLTV
PYEECKRRRSTRVYEPPDPPGYFDGHVWPMYLKHRQEMNSITWDIVYLDGTRSEEDLFSQ
VYEDVKQELEKQNGL
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagacatttgtcattggaattggtggtgtgacaaatggagggaagacaacactggct
aagaacctgcagaaacgccttcccaactgcagcgtaatatctcaggacgacttcttcaag
ccagagtctgagatagacatagatgagaatggttttctgcagtatgatgtgcttgaagca
cttaacatggaaaaaatgatgtcagccgtttcctgttggatggagaacccaggaagctct
gcggggccagcagccttggaaagtgctcaaggggttcccattttaattattgaagggttc
ctgctctttaattataagcctctggacaccatatggaacagaagctatttcctgaccgtt
ccatatgaagaatgtaagagaaggaggagtaccagagtctatgagcctccagaccctcca
gggtacttcgatggccacgtgtggcccatgtacctgaagcacaggcaggagatgaactcc
atcacctgggacattgtttacctggacggaacaaggtctgaagaggacctcttctcccaa
gtgtatgaagatgtcaagcaagaattggagaagcaaaatggtttgtga

DBGET integrated database retrieval system