KEGG   Rattus norvegicus (rat): 499331
Entry
499331            CDS       T01003                                 

Definition
(RefSeq) similar to hypothetical protein D030056L22
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: WRNPLPNID
Other DBs
NCBI-GeneID: 499331
NCBI-ProteinID: NP_001019464
RGD: 1563237
Ensembl: ENSRNOG00000025644
UniProt: Q66H24
Position
1q43
AA seq 166 aa
MAKRRAAEPLTFRVPWKRLLLSDFPEEPPLWVPPSGAARPLKRQGDAGTMAEPASAPRKR
RGGGDDEPELQGRGLEPGEPPPGEQGEPQVSRAAGGGDRVESAGSPQGADEVHSQHNEDF
WQYNTFQYWRNPLPPIDLAALEDVSANSLTETLEDKNEGVEIDMES
NT seq 501 nt   +upstreamnt  +downstreamnt
atggccaagcggcgtgcggctgagccgctcacgttccgcgtgccttggaagcggctcctg
ctcagcgacttccccgaggagccgccgctctgggtcccgccgtctggggcggctcggccc
ctcaagcgccagggggacgcggggaccatggccgaacctgcgtctgcaccccgtaaacga
cgaggcggtggggacgacgaaccggagctgcagggccgtggcctggagcccggagagcca
cctcctggggaacagggggagccccaggtcagccgggccgcgggcggcggcgacagggta
gagagcgcgggcagcccgcagggagccgacgaggtgcacagccagcacaatgaagacttt
tggcagtataatacattccagtattggaggaaccctctaccacctattgatctggcagct
cttgaagatgtgagtgcaaacagcctgacagaaacccttgaggacaagaatgaaggagtt
gagattgacatggagtcctga

DBGET integrated database retrieval system