KEGG   Rattus norvegicus (rat): 499339Help
Entry
499339            CDS       T01003                                 

Gene name
Pum3
Definition
(RefSeq) pumilio RNA-binding family member 3
  KO
K14844  pumilio homology domain family member 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    499339 (Pum3)
   03009 Ribosome biogenesis [BR:rno03009]
    499339 (Pum3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Cargo complex
     499339 (Pum3)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    499339 (Pum3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPL
Motif
Other DBs
NCBI-GeneID: 499339
NCBI-ProteinID: NP_001020207
RGD: 1564753
Ensembl: ENSRNOG00000012574
UniProt: Q562C7
Position
1q52
AA seq 647 aa AA seqDB search
MEVKGKKKITGKSPQTSQGKNKFHKNSESSSAKAFPRKAAKEGGPKVTSKNFEKGATKPG
KKRVKQFKNKPQGGKGPKDKFQKANKFNKKRKFQPDGKSDESAAKKPKWDDFKKKKKELK
QNRQLSDKTNYDVVVRAKHIWESLRRKDCDKEKRVKLMSDLQKLIQGKIKTIAFAHDSTR
VIQCLIQYGSEEQRKWAFEELQGDLVELSKAKYSRNIVKKFLMYGSKPQIAEIIRSFKGH
VRKMLRHSEASAIVEYAYNDKAILEQRNMLTEELYGNTFQLYKSADHPTLEKVLEVQPGK
LELILDEMKQILTPMAQKEAVIKHSLVHKVFLDFFTYAPPKLRSELIEAIREAVVYLAHT
HDGARVAMHCLWHGTPKDRKVIVKTMKTYVEKIANGQYSHLVLLAAFDCIDDTKLVKQII
ISEVISSLPSIVNDKYGRKVLLYLLSPRAPAHLVPEIIQLLQKGDGNAHSKKDTAIRRRE
LLESISPALLSYLQGHTREVVLDKSVCVLVSDILGSATGDAQPAMDAIAGLAAEELYPGG
KDGELHIAEHPAGHLVLKWLIEQDKKIKENGKEGCFAKTLVECVGMKNLKSWASINRGAI
VLSSLLQSCDQDVVNKVKAGLKTLIPTLEKTKSTSKGIQTLLEKLTA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcaaagggaagaaaaaaattacaggaaagagtccacagacatcacaaggaaag
aataaatttcataaaaacagtgagtctagttctgcaaaggcattcccaaggaaagctgct
aaggaaggcgggcctaaagtcacatctaagaactttgagaaaggtgccacaaaacctggc
aagaagcgtgtgaagcagttcaagaacaagccacaagggggcaaaggaccgaaggacaaa
ttccagaaggcaaataaattcaacaagaagcggaaattccagccagatgggaaaagtgat
gaatcagcagccaagaaacccaagtgggatgacttcaaaaagaagaagaaagagctgaag
cagaacagacagctcagtgataagaccaattacgacgtcgtggttcgagcaaagcacatt
tgggagagcttgagaagaaaagactgtgacaaagaaaaaagggtgaagctcatgagtgat
ttgcagaagctgattcaaggaaaaattaaaactattgcctttgcgcatgactcaactcga
gtgatccagtgcctcattcagtatgggagcgaggagcagaggaagtgggctttcgaagaa
ttgcaaggtgacttggttgaattaagtaaagccaaatattccaggaatatcgttaagaaa
tttctcatgtatggaagtaaaccacagattgcggagataatcagaagttttaaaggtcat
gtgaggaagatgctgcggcattcagaggcatcggccattgtggagtatgcgtacaacgac
aaagccattttggaacagaggaacatgctgacagaggagctctatgggaacacatttcag
ctttacaagtcagcagatcacccaacgctggaaaaggtgctagaggtgcagccagggaag
ctagaacttatcctggatgagatgaagcagattctgactcccatggcccaaaaggaagct
gtgattaagcactcactggttcataaagtattcttggacttttttacctatgcaccccca
aaacttcgatcagaactaattgaagccatccgggaagcagtggtgtacctggcccacaca
cacgatggcgccagagtggccatgcattgcttgtggcatggtacacccaaggacaggaaa
gtgattgtgaaaacaatgaagacgtatgtggagaagattgctaatggccagtactctcac
ctggttctcctggcagcgttcgattgtattgatgataccaagcttgtgaagcagataatc
atatcagaagtcatcagctccttgcccagcatcgttaatgacaaatatggaaggaaagtg
ctgctgtacctgctgagcccccgagcccccgcccacttggtgccagagatcatccagctg
ctgcagaagggcgacggcaatgcacacagtaagaaggacactgcaatccgccggcgtgag
ctcttggagtccatctctccagctttgctgagctacctgcaaggacacactcgggaggtg
gtgctggacaagtccgtgtgtgtgctggtgtctgacatcctgggatctgctactggggac
gctcagcctgctatggatgccatcgccggtttggcagcagaggaactgtatcctgggggc
aaggacggagagctccacattgctgagcatcctgcaggacatctggtcctcaaatggtta
atagagcaagataaaaagataaaagaaaatggaaaagaaggttgttttgcaaaaaccctt
gtagagtgcgttggtatgaagaacctcaagtcctgggccagcatcaaccgaggagccatc
gttctttccagccttcttcagagttgtgaccaggacgttgtaaacaaagtcaaagctgga
ctgaaaaccctgattcctaccttggaaaaaaccaaaagcaccagcaaaggcatccagact
ctgcttgagaagttgactgcatag

DBGET integrated database retrieval system