KEGG   Rattus norvegicus (rat): 499356Help
Entry
499356            CDS       T01003                                 

Gene name
Blnk
Definition
(RefSeq) B-cell linker
  KO
K07371  B-cell linker protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04380  Osteoclast differentiation
rno04662  B cell receptor signaling pathway
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    499356 (Blnk)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    499356 (Blnk)
  09158 Development
   04380 Osteoclast differentiation
    499356 (Blnk)
 09160 Human Diseases
  09162 Immune diseases
   05340 Primary immunodeficiency
    499356 (Blnk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2
Motif
Other DBs
NCBI-GeneID: 499356
NCBI-ProteinID: NP_001020938
RGD: 1561933
Ensembl: ENSRNOG00000013967
UniProt: Q4KM52
Position
1q54
AA seq 457 aa AA seqDB search
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMDKIKKLKVKGPPSVPRRDYALDNPADE
EEQWSDDFDSDYENPDEHSDSEMYVMPAEETGDDSYEPPPAEQQTRVVHPALPFTRGEYV
DNRSSQRHSPPFSKTLPSKPSWPSAKARLASTLPAPNSLQKPQVPPKPKDLLEDEADYVV
PVEDNDENYIHPRESSPLPAEKAPTVNRSTKPNSSSKHVSPPGTVAGRNSGVWDSKSSLP
AAPSPLPRAGKKTATPLKTTPVPSLQNASNVCEEKPVPAERHRGSSHRQDTVQSPVFPPT
QKPVLQKPVPLPRFTEGGSPAADGPVPSFPFNSTFADQEAELHGKPWYAGACDRKSAEEA
LHRSNKDGSFLIRKSSGHDSKQPYTLVAFFNKRVYNIPVRFIEATKQYALGKKKNGEEYF
GSVVEIIKNHQHNPLVLIDSQNNTKDSTRLKYAVKVS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactgaataaaataactgtccctgccagtcagaagctgagacagcttcagaag
atggtccacgatattaagaacaatgaaggtggaataatggacaagataaagaagctaaaa
gtcaaaggacctccaagtgttcctcgaagggactatgcattagacaaccccgcggacgaa
gaggagcaatggtcagatgactttgacagcgactatgaaaatccagatgaacattcggac
tccgagatgtatgtgatgcccgcagaggagacgggggacgattcctatgagccgcctccc
gctgagcagcagacacgggtggtccatccagccctgcccttcacgaggggcgagtatgta
gataatcgatccagccagcggcactctccacccttcagcaagacacttcctagtaagccc
agctggccttcagcgaaagcaaggctggcctccactctgccagcccccaactctctacag
aagcctcaagtcccccccaagcccaaagacctccttgaggatgaggctgattatgtggtc
cctgtggaggataacgatgaaaactatatccatcccagagaaagcagcccgctgcctgct
gagaaagctcccacggtgaatagatcaaccaaaccaaacagctcctcaaagcatgtgtcc
cctccagggactgtcgcaggtcgaaacagtggggtctgggactccaagtcatctttgcct
gctgcaccatccccactgccacgagctgggaagaaaacagctacaccacttaagacgact
cccgttccttccctacagaacgcatcaaatgtttgtgaagaaaagcctgttcctgctgag
cgccaccgagggtctagtcacagacaagacactgtacagtcaccagtgtttcctcccacc
cagaaacctgtccttcaaaagcctgtacccctgccaaggttcacagaagggggaagccca
gctgcagacggaccggtacctagcttcccatttaattctacttttgcagaccaggaggct
gaactgcacggtaagccctggtacgctggcgcctgcgaccgcaagtctgctgaagaggcc
ttgcaccgatccaacaaggatggatcatttcttattcggaaaagctccggccacgattct
aagcagccgtacacactagttgcgttctttaacaagcgtgtatataatatccctgtgcgg
ttcatcgaagcaaccaaacaatatgctttgggaaagaagaaaaatggcgaagagtacttt
ggaagcgttgtggagatcatcaagaatcaccagcacaaccccctggttcttattgacagt
cagaataacacaaaagactccacgagactgaaatacgccgtgaaggtttcataa

DBGET integrated database retrieval system