KEGG   Rattus norvegicus (rat): 499390Help
Entry
499390            CDS       T01003                                 

Gene name
Clasrp, Sfrs16, Srsf16
Definition
(RefSeq) CLK4-associating serine/arginine rich protein
  KO
K13168  splicing factor, arginine/serine-rich 16
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    499390 (Clasrp)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR proteins
    499390 (Clasrp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRY_EERY
Motif
Other DBs
NCBI-GeneID: 499390
NCBI-ProteinID: NP_001019465
RGD: 1563538
Ensembl: ENSRNOG00000046000
UniProt: Q5HZB6
Position
1q21
AA seq 668 aa AA seqDB search
MWHEARKHERKLRGMMVDYKKRAERRREYYEKIKKDPAQFLQVHGRACKVHLDSAVALAA
ESPVNMMPWQGDTNNMIDRFDVRAHLDHIPDYTPPLLTTISPEQESDERKCNYERYRGLV
QNDFAGISEEQCLYQIYIDELYGGLQRPSEDEKKKLAEKKASIGYTYEDSTVAEVEKVAE
KPEEEESPAEEESNSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLR
KDKEEAEAIKHAKALEEEKAMYSGRRSRRQRREFREKRLRGRKISPPSYARRDSPTYDPY
KRSPSESSSESRSRSRSPSPGREEKITFITSFGGSDEEAAAAAAAAAASGAAPGKPPAPP
QPGGPAPGRNASARRRSSSSSASRTSSSRSSSRSSSRSRRGYYRSGRHARSRSRSWSRSR
SRSRRYSRSRSRGRRHSDGGSRDGHRYSRSPARRSGYAPRRRSRSRSRSGDRYKRGARGP
RHHSSSHSRSSWSLSPSRSRSLTRSGSRSQSRSRSRSQSHSQSQSHSPSPPREKLTRPAA
SPAVGEKLKKTEPAAGKETGAAKPKLTPQERLKLRMQKALNRQFKADKKAAQEKMIQQEH
ERQEREDELRAMARKIRMKERERREKEREEWERQYSRQSRSPSPRYSREYSSSRRRSRSR
SRSPHYRH
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtggcacgaggctcggaagcatgagcggaaacttcgaggcatgatggtggactacaag
aagagggcagagcggcgtcgggaatactatgagaagattaagaaagaccccgcccagttc
ctgcaggtacatggccgagcctgcaaggttcacctggattctgcagttgccctggctgct
gagagccctgtgaacatgatgccctggcagggagacaccaacaacatgatcgaccgcttt
gatgtccgtgcacatctagaccacatccctgactatacgcccccactgctcactaccatc
tccccagaacaggagtcagacgagcggaagtgtaactacgagcgctaccgaggcctggtg
cagaacgacttcgccggcatctctgaggaacagtgcttgtatcagatctatattgatgag
ctgtatggaggcctgcagagacccagcgaggatgagaagaagaagctggcagagaagaag
gcttccatcggctacacctatgaagatagtactgtggctgaggtagaaaaggtggccgag
aagccagaggaggaagagtcaccagcagaggaggagagcaactcggatgaagatgaggtc
atccccgacatcgacgtggaggtggatgtggatgagctgaaccaggagcaggtggctgat
ctcaataagcaggccacaacctacggcatggctgacggggacttcgtcaggatgctacgg
aaagacaaggaggaggcagaggccatcaaacatgccaaggccctggaggaggagaaagcc
atgtactcgggccgtcgttcacggcgacagcgaagagagttccgggagaagcggctgagg
ggccgtaagattagccctcccagttatgcccgccgagacagccccacctatgacccctat
aagcggtcaccttcggaatccagttccgagtcccgctcccgctctcgctccccgagccca
ggccgcgaggaaaaaatcacttttatcacgagttttggaggcagcgacgaggaggcagct
gcagcagctgctgcagccgccgcatccggggctgccccagggaagccccccgcgcctccc
caaccgggtggccccgctccaggccgtaatgccagcgcccgccgccgctcctcttcgtcc
tccgcctccaggacctccagttcccgatccagttcgcgctccagctcgcgctcccgccgt
ggctattaccgttctggccgccacgcgcgctctcgctcccgctcctggtcccgctcgcgc
tcccgttcccggcgctattcccgctcccgcagccgtggacgacggcactcagacggtggt
tcccgcgacggacaccgctactcacgctcgccagcccggcgcagcgggtacgcgccccgc
cgaaggagcaggagccgctcccgttcaggtgaccgctataagcggggtgcccggggcccc
aggcaccacagcagcagtcatagccgcagcagctggtccctcagcccttcccgaagccgc
agtctgacccggagtggaagccgaagccagagccggagcagaagccgcagccagagccac
agccagagccagagtcactcgccatcgcccccaagggagaagctgaccaggccagcagca
tcccctgctgtgggcgagaagctgaaaaagaccgaacctgccgctggtaaagagacagga
gctgccaaacccaagctgaccccacaggagaggctgaagctgcggatgcagaaggctctg
aaccgccagttcaaggcggataagaaggcagctcaggagaagatgatccagcaggagcac
gagcggcaggaacgcgaggatgaactgcgagccatggcccgaaagatccgaatgaaggag
cgagagcgacgagagaaggagagagaagaatgggagcgccagtacagccgccagagccgc
tcaccctccccacgctacagtcgagagtacagttcttcccgcaggcgttcgaggtccagg
tcccgaagcccccattacagacattag

DBGET integrated database retrieval system