KEGG   Rattus norvegicus (rat): 499486Help
Entry
499486            CDS       T01003                                 

Gene name
Gpr150, RGD1564729
Definition
(RefSeq) G protein-coupled receptor 150
  KO
K08434  G protein-coupled receptor 150
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    499486 (Gpr150)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    499486 (Gpr150)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 499486
NCBI-ProteinID: NP_001102643
RGD: 1564729
Ensembl: ENSRNOG00000026944
UniProt: D3ZHL8
Position
2q11
AA seq 427 aa AA seqDB search
MEDPFSPSTLSPVSNLSLPIRQSWGLNLTSKQGTSVPGPQPPPRWPPSHRIHLVFLGIIL
AASVAGNTTVLCRLCGSSSRPWLGPKRRKMDFLLVQLAAADLYASGGTALSQLAWELLGD
PRPALGNLACRLSQLLQTSGRGASAHLVALIALERQLAVRGPQGPQLPARALTTLSWLLA
LLLALPPTFVVRWEAPPSSTASAWPGEHRCHDIFAPLPRWHLQVYALYEAIVGFAAPVAI
LGVSCGHLLCVWWRRGSQASVAGMPWSASMARASLPSALPRAKVQSLKMSLALALLFVGC
DLPYFAARLAAAWSSGHRGDWEGESLVAAMRVVEVANSAVNPLVYLFFQTGDCRLWRRLR
RRIGVLCCVQEEEAEISGGAGDHQALHRHRWPHPHYHHARREERDQGGLRPPPPRPRPLP
CSCESAF
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaagatcccttcagcccctcaactctgtctccggtgtctaacctatccctacccatt
cggcagagctggggtctcaacctcacttctaagcagggaacctctgtgccgggaccgcag
ccgcctccacgctggccacctagccaccggatccatctggtcttcttggggatcatcctg
gcggcctcggtagctggcaacaccacagtgctctgccgcctgtgcggcagtagcagccga
ccctggctgggtcccaagcgtcgcaagatggacttcctgctggtgcagctagcagcggct
gacctgtacgcgagtggaggcaccgcgctgtcgcagctggcttgggagttgctgggcgac
ccgcgacctgctctgggcaacttggcttgccgcctttcccagttgctgcagacatctggg
cggggcgcctccgcccacctggtggcgctcattgctttggagcgccagctcgcagtgcga
ggtcctcagggcccacagttgcccgcacgcgccctgactaccctgagctggctgctggct
ctgctgcttgctctgccgcccaccttcgtggtgcgctgggaagcgcctccatcttcaacc
gccagcgcctggcccggggagcatcgctgccacgacatcttcgcccccctgccgcgctgg
cacctgcaggtctacgcgctctacgaggctatcgtgggcttcgcggcgccagtcgcgatc
ttgggtgtctcttgcggtcacctgctgtgtgtctggtggcggcgcgggtctcaggcttcg
gtggctgggatgccctggtccgccagtatggctcgagcctccttacccagtgcgctgccc
cgcgccaaggtgcagagcttgaaaatgagcctggcactggcactgctcttcgtgggctgc
gacctgccctactttgcagctcgcttggcagccgcctggtcgtcggggcaccggggtgat
tgggagggagagagcctggtagccgcgatgcgggtcgtagaggtggccaacagcgctgtc
aatcctttggtctaccttttcttccagacgggtgactgccgtctctggcggcggctacgg
aggcgtataggagttctgtgctgcgtgcaggaggaagaagccgagatcagcggaggggct
ggggaccaccaggcactccaccgccatcgctggccccacccccattatcaccatgcccgg
cgggaggagcgggaccaaggcggcctgcgcccacccccgccacgccccagacctctgccc
tgctcctgtgaaagtgccttctag

DBGET integrated database retrieval system