KEGG   Rattus norvegicus (rat): 499497
Entry
499497            CDS       T01003                                 

Gene name
Mef2c
Definition
(RefSeq) myocyte-specific enhancer factor 2C isoform X1
  KO
K04454  MADS-box transcription enhancer factor 2C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04371  Apelin signaling pathway
rno04921  Oxytocin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05202  Transcriptional misregulation in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    499497 (Mef2c)
   04371 Apelin signaling pathway
    499497 (Mef2c)
   04022 cGMP-PKG signaling pathway
    499497 (Mef2c)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    499497 (Mef2c)
   04928 Parathyroid hormone synthesis, secretion and action
    499497 (Mef2c)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    499497 (Mef2c)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    499497 (Mef2c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    499497 (Mef2c)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    499497 (Mef2c)
SSDB
Motif
Pfam: SRF-TF HJURP_C
Other DBs
NCBI-GeneID: 499497
NCBI-ProteinID: XP_006231793
RGD: 1563119
Ensembl: ENSRNOG00000033134
Vega: OTTRNOG00000000103
UniProt: A0A096MJY4
Position
2
AA seq 473 aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
NEDIDLMISRQRLCAVPPPNFEMPVTIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNIQAKS
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT
PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP
SALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggggagaaaaaagattcagatcacgaggattatggatgaacgtaacagacaggtgact
tttacaaagaggaaattcggactgatgaagaaggcttatgagttgagcgtgctgtgcgac
tgtgagattgccctgatcatcttcaacagcaccaacaagctgttccagtacgccagcacc
gacatggacaaggtgctgctcaagtacaccgagtacaacgagccgcacgagagccggaca
aactcggacattgtggagacattgagaaagaagggccttaatggttgtgacagccccgat
cccgatgcagacgattcagtaggtcacagccctgagtctgaggacaagtacaggaaaatt
aacgaagatattgatctaatgatcagcaggcaaagattgtgtgctgttccacctcccaac
tttgagatgccagttaccatcccagtgtccagtcataacagtttggtatacagcaaccct
gtcagctcactgggaaaccctaatcttctgccactggcccacccttctctgcagaggaat
agtatgtctcctggtgtgacacatagacctccaagtgcaggtaacacaggtggtctgatg
ggtggagacctcacatccggtgcaggcaccagtgcagggaatggatacggcaacccccgg
aactcaccaggcctgctggtctcacctggtaacctgaacaagaatatacaagccaaatct
cctccccctatgaatctaggaatgaataatcgtaagccagatctccgcgtcctcatcccc
cctggcagcaagaacacaatgccatcagtgtctgaggatgtggacttgctgttgaatcaa
aggataaataactcccagtcggcccagtcattggctaccccagtggtttctgtagcaact
cctactttaccaggacaaggaatgggaggatatccgtcagccatttcaacaacatatggt
accgaatactctctgagcagcgcagatctgtcatctctgtctggcttcaatactgccagt
gcgctccacctcggctccgtcactggctggcagcagcagcacctacataacatgccgcca
tctgccctcagtcagttgggagcttgcactagcactcatttatctcagagttcaaatctc
tccctgccttctactcaaagcctcaacatcaagtcagaacctgtttctcctcctagagac
cgtaccaccaccccatcgagatacccacaacacacgcgccacgaggcggggagatctcct
gttgacagcctgagcagctgtagcagttcctacgatgggagcgaccgggaggatcaccgg
aacgaattccactcccccattggactcaccagaccttcgccggacgaaagggaaagtccc
tcagtcaagcgcatgcggctctctgaaggatgggcaacatga

DBGET integrated database retrieval system