KEGG   Rattus norvegicus (rat): 499507Help
Entry
499507            CDS       T01003                                 

Gene name
Fam151b, RGD1561110
Definition
(RefSeq) family with sequence similarity 151, member B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2181
Motif
Other DBs
NCBI-GeneID: 499507
NCBI-ProteinID: NP_001128220
RGD: 1561110
Ensembl: ENSRNOG00000024136
UniProt: B2RZ92
Position
2q12
AA seq 276 aa AA seqDB search
MAASAGGPGSWSENILTYFLRNRQITAEDGAEILWYHAANHKCQMSDALKSAAHMIEADV
LLPSDGSEHGQPIMAHPPETGSDNTLQEWLAEVTKSNKGIKLDFKSLAAARASMLFLDNV
KQHLQRPVWINADVLPGPNGSSKVVDAKAFLDTVTSFFPDVTFSLGWTTGWHPEKVNEGY
TWPMVKEMDYICSELTQPVTFPVRAALVRQSCSQLLWLLTKSSRYSLTVWTGKDDIYPTE
DLLYIRDCFNKTQVFYDILEPQNYEFKQAIGIRVTL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaagtgctgggggcccgggatcctggagtgaaaatatactaacgtattttctg
aggaacaggcagatcacggcagaagacggtgctgagatactctggtaccacgcagcgaac
cacaagtgtcagatgagcgacgccctgaagagtgccgcccacatgatcgaggctgatgtc
cttcttcctagcgacggctcagagcatggccagccaatcatggcccacccgcccgagaca
ggcagtgacaacactctgcaggagtggctggctgaggtcacgaagagcaacaaaggcatc
aagttggatttcaagagtctggcagccgcccgagcatccatgctgttcctggacaatgtg
aagcagcacctgcagcggcctgtgtggattaatgccgacgtccttcctgggccaaatggg
agcagcaaagtagtagacgccaaagcctttctggacaccgtgacgtccttcttcccagac
gtgaccttttccttgggttggacaacagggtggcatcctgagaaagtcaatgaaggatac
acctggccgatggtgaaagagatggactacatatgcagcgagctaacccagcctgtcacc
ttccctgtcagggcagctttggtgaggcagtcgtgctctcagttgctctggctattgacg
aaatcgagcaggtacagcttgaccgtgtggactggaaaagacgacatttaccccactgaa
gatttactttacattcgagactgctttaacaaaacccaagttttctatgatattttggaa
ccacaaaactatgaatttaaacaagccattggaatccgagtcactctctaa

DBGET integrated database retrieval system