KEGG   Rattus norvegicus (rat): 499566
Entry
499566            CDS       T01003                                 

Gene name
Car13, RGD1560453
Definition
(RefSeq) carbonic anhydrase 13
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00910  Nitrogen metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    499566 (Car13)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     499566 (Car13)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 499566
NCBI-ProteinID: NP_001128465
RGD: 1560453
Ensembl: ENSRNOG00000021323
UniProt: B5DFG6
Position
2q23
AA seq 262 aa
MARLSWGYDEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcgaggttaagctggggatacgacgagcacaacggtcctattcactggaatgaattg
ttccctattgcggatggtgatcagcagtctccaattgagattaaaaccaaagaagtgaaa
tacgactcctcactccgacctctcagtatcaagtatgatcctgcctcggctaaaatcatc
agcaacagtggccattccttcaacgttgactttgacgacacagaggacaaatcagttctg
cgtggaggtcctctcactggaagctacaggttgcggcagttccatctgcactgggggtca
gcagacgaccatggctctgagcatgtggtggatggcgtgaggtatgctgcagagctgcat
gttgtccactggaattcagacaaataccccagttttgtagaggcagctcatgagtccgat
gggctggctgtcctgggagtatttctacagattggggaacacaatcctcaactgcaaaag
atcacggacattttggattccattaaggaaaagggtaaacaaacacggttcacaaatttt
gaccccttatgtttgcttccgtcatcctgggactactggacataccctggttctctgacg
gttccacctcttcttgagagtgtcacgtggattgttttaaaacaacctataagtatcagc
tctcaacagttggccagattccgaagcctcttgtgcacagctgagggcgagagtgcggct
ttcctgttaagcaatcaccgtccgccacagcccctgaagggccgcagagtgagagcatct
ttctattag

DBGET integrated database retrieval system