KEGG   Rattus norvegicus (rat): 499626Help
Entry
499626            CDS       T01003                                 

Gene name
Erich6, Fam194a
Definition
(RefSeq) glutamate-rich 6
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM194
Motif
Other DBs
NCBI-GeneID: 499626
NCBI-ProteinID: NP_001019471
RGD: 1559451
Ensembl: ENSRNOG00000013662
UniProt: Q5XI56
Position
2q26
AA seq 602 aa AA seqDB search
MEDDIWKAVDLSGVFDEDSVELRPRLTSVSSPSLSSTPPPSPLSSPSWSEEELPAPRSDG
SPASSISAHKSYPKIFQTFKKDLSEVTVDRLMYPSFYERVQISIQTEDQSWLQRISARKR
IKRIPSIEITEAPQENLASKLRENWVINPEEPKLSILCEMEFNEDFVNFFETSLRTLPSI
GPPTILSYRKEYSCMDVILKDEQELGATCEFCGSDLQSLFFNMDTSLDDAGTKGKSHRSC
CLQFQNLLDYITEERLTTKSPEMELISISPHAAHGSDADRLKAKEKAMQRKQERQMARHF
TIIPEQSPVGTEEDTKHLKTISYQLSGDYLQNVRTEEVDLQITNISITCCDSWKICGKVM
GNELLEKDYKHGSKFLTSFPDGTIQIFYPSGNLAIIRVPNKTDGFICIIQEDTATSPAIL
ALFDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRTWNWSSTKPTPAFVSFKPVLLA
LNRYIGIRILEQDKVSIHFLAMGQQATICLGTKVVLQDPEEVPTLRFLSGDDLLLLASLI
KIRRLFSKMEGCVNFPVSKAWERLKQPSYLSSLSLKLLALCQNSGIQQNIMETITELIKE
NE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgatatctggaaggcggtggacctcagtggagtctttgacgaagactcggtg
gaacttcgtccccgcctaactagtgtgtccagccccagcctgagctctacgcccccgccc
agcccgttgtccagtccctcatggagcgaagaagagctgccagcgccacgcagcgacggt
tctcctgcttccagcatctcggcccacaaaagctatcccaaaatatttcaaacatttaag
aaagacttgtctgaagtgactgtagatagacttatgtacccaagtttctatgaacgagtt
cagatatcgatacaaacagaagaccaaagttggcttcaacgaatttctgctagaaagcga
ataaaaagaataccatccattgagataacagaagcgccccaagaaaatctggcttctaag
ttaagagaaaactgggtaattaatcctgaggagcccaagctaagcattttatgtgagatg
gagtttaacgaagactttgtaaatttttttgaaacttctctaaggacattacccagcatt
gggccaccaaccattctgtcatacagaaaagagtactcctgtatggatgttatcttgaag
gatgaacaagagctgggagccacatgtgaattctgtggaagtgatctacagtcactgttt
tttaatatggacacttcccttgacgatgctggaaccaaagggaaatcacataggagctgc
tgtcttcagtttcaaaacctccttgattatatcactgaggaaaggctaaccaccaaaagc
cccgaaatggaattaatcagtatttcgcctcacgcagcgcatggcagtgatgccgacaga
ctcaaggcaaaggagaaggctatgcagaggaaacaagaacgtcagatggccaggcatttc
acaataataccagagcagagccccgtgggaactgaggaagatacaaagcatttgaagaca
atttcttatcagctttctggagattacctacagaatgtgcgcactgaagaagttgatctt
cagatcactaacatctccatcacttgctgtgattcctggaaaatatgtgggaaggtcatg
gggaatgagctcctggagaaggattacaagcacggaagcaagtttctcacttcctttcct
gatgggacgatacaaatattctatccgtctggaaacctagccattatccgagtacccaac
aagacagatgggtttatttgtataatccaagaagacacagccaccagccctgctatcctg
gcactgtttgactcctccggcagaagctcctgctatcaccccaatggaaatgtctgggta
tacatcaacatcttgggcggccaatactcagatcaagccggcaacaggatacgaacttgg
aactggtcgagtaccaagcctaccccagcctttgtctcctttaaacctgtccttctggcc
ctgaaccgttacattggaatccgcatcctagaacaagacaaggtctccattcattttcta
gcaatgggccaacaggcaacaatctgccttgggaccaaagtagtgctccaggatccagag
gaggttccaaccctgaggttcctgagtggagacgaccttctgctgttggccagcttaata
aagatccggcggctgttcagtaagatggaaggatgtgtgaatttccctgtaagtaaggct
tgggaaagactgaagcaaccttcctacctttcttcactctccctaaaactgcttgccctc
tgtcaaaattctggcatacagcaaaacataatggaaactattacagagctaataaaagaa
aacgagtga

DBGET integrated database retrieval system