KEGG   Rattus norvegicus (rat): 499653Help
Entry
499653            CDS       T01003                                 

Gene name
Gon4l, Dingo, Yarp
Definition
(RefSeq) gon-4 like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PAH Myb_DNA-bind_6 Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 499653
NCBI-ProteinID: NP_001019968
RGD: 1564691
Ensembl: ENSRNOG00000020297
UniProt: Q535K8
Position
2q34
AA seq 2256 aa AA seqDB search
MLPCKKRSGVTESAQQQDDQEGEDLHLEAAVKPDTDQLPDCTSESLSWGQSHDSAGCPEV
HSMQDVGSQLSVEGTPLSSKMLTQRVNLAVSEAVDVPVSQEIPVPSLESSHSLPVHMGKG
RLQSTASRKGKKIAFMPGQVTREDGGDHTVPEEPPSGEHAEEVKAEGGELEMHSEGDLPS
LSSGSQSAKPRAQPRKSFQPDGSAFPQEKSLGPLVRQAEEDMEDGGLFIPTEEQDGEESD
KRKKTKKGTKRKRDGRGQEQGTMTYDPKVDDMLDRTLEDGAKQHNLTAVNVRNILHEVIT
NEHVVAMMKAAISETEDMPLFEPKMTRSKLKEVVEKGVVIPTWNISPIKKASETKQPPQF
VDIHLEDDDSSDEEYQPDEEEEDETAEESLLESDVESAASSPRGVKRSRLRLSSEAAEAD
EESGVLSEVEKVATPALRHISAEVVPMGPPPPPKPKQTRDSTFMEKLNAVDEELAASPVC
MDSFQPMEDSLIAFRTRSKMPLKDVPLGQLEAELQAPDITPDMYDPNTADDEDWKLWLGG
LLNDDVENEDEADDDDDPEYNFLEDLDEPDTEDFRTDRAVRITKKEVNGLMEELFETVQS
VVPSKFQDEMGFSNMEDDGPEEEERVTESRPSFNTPQALRFEEPLANLLNERHRTVKELL
EQLKMKKSSVRQQPEVEKLKPQTEKVHQTLVLDPAQRSRLQQQMQQHVQLLTQIYLLTTS
NPNLSSEASTTRVFLKELGTFAENSTALHQQFNPRFQTLFQPCNWVGAMQLIEDFTHISI
DCSPHKTVKKTASEFPCLPKQVAWILATNKVFMYPELLPICSLKANNPRDKTIFTKAEDN
LLALGLKHFEGTEFPKPLISKYLVTCKTAHQLTVRIKNLNLNRAPNNVIKFYKKTKQLPV
LVRCCEEIQPHQWKPPIEKEEHRLPFWLKASLQSIQEELRNLAGGATAGGSVTAATETST
DQHLQKTSPVVGGDTQYPLLLPKGVVLKLKPGSKRFSRKAWRQKRPLVQKPLLIQPSPSV
QPVFNPGKMATWPTQSEVPPSNTVVQIPHLIQPAAVLQTLPGFPSVGVCGEDSFESPAAL
PAMPSGSEARTSFPWSESQSAPPSSSAPKLMLPSLGPSKFRKPYVRRKPTRRKGAKASPC
VKPAPIIHPTPVIFTVPATTVKVVSLGGGCNMIQPVTAAVAPSPQTIPITTLLVNPTSFP
CSLNQPLVASSISPLLVSSNPLALPVTSLPEEKAHVSLDIAEGKNAPQNPEPKIKPQEPT
PQCATVFSKEEPRSWHPSADTGNQEAVSESSACSWAAVKTEGQEGSSEKSVCGWTVVKTE
DGGHAVQPLPQDPQDSLNSPSKDLLNMVKLEAEDCMEEISSDFPKQDIGEEVKEECCMEL
DRDSPQEKASSVSEMSKQTATPREETQAAKSPTVSQDAPDAIRDASKGLPQSTLSSMDQG
TVLNSPPGKPEDSANADGQSVGTPAGTDTGAEKDGAEEEEEEDFDDLTQDEEDELSSASE
ESVLSVPELQETMEKLTWLASERRMSQEGESEEENSQEENSEPEEEEEEEAEGMETLQKE
DEATDEAGGGAAEKPPSTLASPHTAPEVETSITPAGESIKAAGKGRSSHRARSRRGSRAR
ASKDASKLLLLYDEDILDRDPLREQKDLAFAQAYLTRVREALQHIPGKYEDFLQIIYEFE
SNAQMHSAVDLFKSLQTLLHDWPQLLKDFAAFLLPEQALSCGLFEEQQAFEKSRKFLRQL
EICFAENPSHHQKIIKVLQGCADCLPQDITELKTQMWQLLRGHDHLQDEFSIFFDHLRPA
ANRMGDFEEINWTEEKEYEFDGFEEVILPEVEEEEEPAKVSTASKSKRRKEIGVQHQDKE
SEWPEAAKDGSCPCHEGGPESKLKKSKRRNCHCSSKVCDSKSYKSKEPLELVGSGPLQEA
STVPGTKEAGQGKDMSEEETMEGQENVEVSQNKTGRTTRKGEAPIPGSTVRTALLCSAEV
TPIELSLEGPTCCSPETPRLPPQTGAVVCSVRRNQAGPEVVSCLGTSSIPPKEGEDQKAV
ANSETIAPLPETSETERLPGTVELPAPLPSPVSLSTRDTGRRHIYGKAGTQSWLLDNRAE
AKAAHMVAPIRGTSSGASASEAAPTASREGLAEDSETQGKGPEAVLPKASEATVCANNSK
VSSTGEKVVLWTREADRVILTMCQEQGAQPHTFSVISQQLGNKTPVEVSHRFRELMQLFH
TACEASSEDEDDATSTSNADQLSDHGDLLSEEELDE
NT seq 6771 nt NT seq  +upstreamnt  +downstreamnt
atgttgccttgtaagaagagaagtggagtgaccgagtctgcgcagcagcaagatgaccag
gagggcgaagatttacacctagaggctgctgtgaagccagacacggaccagctcccagac
tgcacgtcagagtcactgtcctggggtcagagtcacgacagtgcagggtgccctgaagtg
cactccatgcaggatgtgggcagtcagctcagtgtggagggcacgcctttaagctcgaag
atgctcacccagcgtgtgaacttagcagtatcagaagctgttgatgtaccggtctctcag
gaaatccccgttccttccttggagtcttctcattcccttcctgtacatatgggtaaaggg
agactccagtccactgcctcaaggaaagggaagaaaattgccttcatgcctgggcaggtc
accagagaagacggaggggatcacactgtcccagaggagcctccttcaggagagcatgcc
gaagaagtcaaggcagaaggaggagaacttgagatgcattctgaaggggatttaccttcg
ctgtcatcaggcagtcaatctgcaaaaccgcgtgcccagcctaggaagtcattccagcca
gacggttctgcctttcctcaagaaaagtcactcggacctctggttcgccaagctgaggaa
gacatggaggatggtggactctttattccaaccgaagagcaagatggtgaagaaagcgat
aaaaggaaaaaaactaaaaagggaaccaagaggaagcgagatggaaggggtcaggagcaa
gggacgatgacgtacgacccaaaagtggatgacatgctggaccgcaccttagaggatggt
gccaagcagcacaatctgacagcagtaaatgtccgaaacatcctgcatgaagtaatcacg
aacgaacacgttgtggccatgatgaaggcggccatcagtgagacagaagacatgccgctg
tttgagcctaagatgacacgctctaaactgaaggaagttgtggagaaaggagtggtaatt
ccgacttggaatatttcaccaattaagaaagccagtgaaactaagcagcccccacagttt
gtggatattcacctggaagacgatgactcctcagatgaagagtaccagccagacgaggaa
gaggaagacgagacagctgaagagagcttgttggaaagcgatgttgaaagcgctgcttcg
tctccacggggagtgaagaggtccagactgcgactgtcctctgaagcggccgaggcagat
gaggagagtggcgtgttgtccgaggttgagaaggttgccacccctgctcttaggcacatc
agtgctgaggtcgtgcccatggggcctccacctcctccaaaaccaaagcagaccagagac
agcactttcatggagaagctaaacgcagtggacgaggagctggcagctagtcctgtctgc
atggattctttccagcccatggaggatagtctgattgcgttccgaacacgttctaagatg
cctctgaaagatgtccctctgggccagctggaggctgagcttcaggctccagacatcact
ccggatatgtatgacccaaacacagctgatgatgaggactggaagctgtggctggggggc
cttctaaatgacgacgtggagaacgaggacgaagcagatgatgatgatgatccagaatat
aacttcctggaagatcttgatgaaccagacacagaggactttcgaactgaccgtgcagtg
agaatcactaaaaaagaagtgaatgggttgatggaggagctgtttgagacggtgcaatct
gtagtccccagtaagttccaagatgaaatgggattctccaatatggaagacgatggccca
gaggaagaggagcgtgtaacagaatcccggcctagcttcaacacccctcaagccctacgg
tttgaggaaccattggccaacttactaaacgaacgacatcggacagtgaaagagctgctt
gaacagctgaaaatgaaaaaatcttcagtccgacagcagcctgaagtggagaagctgaag
cctcagacggagaaagtccatcagactctggttcttgacccggcacaaaggagcaggctt
cagcagcagatgcagcagcatgttcagctcttgacacaaatctaccttctcaccacctcc
aaccccaacctcagctccgaggccagtaccaccagagtatttctgaaagagctgggcacc
tttgctgagaactccactgctcttcaccagcagttcaaccccaggttccagaccttgttc
cagccttgtaactgggtgggggctatgcagctcattgaagacttcacccacatcagcatt
gactgcagtcctcataaaaccgtcaagaagactgccagtgaatttccctgtttgccaaag
caagtggcttggatcctggccacaaacaaggttttcatgtatccagagctcctcccaata
tgttcgctgaaggcaaataatcctcgggataagaccatctttaccaaggctgaggacaat
ctgttagccttaggactgaagcacttcgaagggactgagtttccaaagcctctgatcagc
aagtaccttgtgacttgtaagaccgctcaccagctgacggtgaggatcaagaacctcaac
ctgaatagagctcccaacaacgtgattaaattttataagaagaccaaacagctgccagtt
ctggtgaggtgctgtgaagagatccagccacatcagtggaagccgcctattgagaaagaa
gaacaccggcttccattctggttaaaggctagtctacagtccattcaggaagaactgcgg
aacctagccggaggcgctacagcgggaggaagtgtgaccgcagccactgagaccagcaca
gatcagcacttgcagaaaaccagccctgtcgtgggtggtgacactcagtacccactgctg
ctgcccaagggtgtagtactgaagctgaagccgggttccaagcgcttctccagaaaggct
tggcgacagaagcggcccttggtccagaagcctctcctcatccaacccagcccgtctgtt
cagcctgtgttcaaccctgggaaaatggcaacctggccaactcagtctgaagtccctcca
agcaacacggtggtccagattcctcatctgatccagccagctgctgtcttacagactctt
ccaggtttcccttcggtgggggtctgtggagaagacagctttgagtctcccgcagcactg
cctgccatgccttctgggtctgaagccagaaccagcttcccctggtctgagtctcagtca
gcaccaccttcgtcctctgcacccaaattaatgcttccctcacttggcccctctaaattt
cgaaagccatatgtaaggcgtaagcccacaagaagaaaaggagccaaggcttccccctgt
gtgaaacctgctcccatcatccaccccacacctgtcatcttcacagttcctgccaccaca
gtgaaggttgtaagcctaggcggtggctgtaacatgatccagcctgtcacagcagctgta
gcacccagtccccagaccatccctatcaccactctgcttgtcaaccctacttctttcccc
tgttcattaaaccaacccctcgtggcctcctccatctcccccttacttgtttccagcaat
cccctggctctccctgtgacatctcttcctgaagagaaggctcacgtgagcttggatatt
gctgaagggaaaaatgctcctcagaaccccgagcccaaaataaaaccccaggaaccaacc
cctcagtgtgctactgtcttctccaaagaggagcccaggtcctggcatccttcagcagat
acaggaaaccaggaagcagtctctgaatccagtgcctgcagctgggctgctgtgaaaaca
gaaggccaggaagggtcttcagagaagagtgtttgtggctggactgttgtgaaaacagaa
gatggtgggcatgctgtgcagccattgcctcaggatccccaggactctctgaactctcca
tcgaaggatttattaaacatggtcaagttggaagccgaggattgtatggaggagatctcc
agcgacttccccaagcaggacattggcgaggaagtgaaagaggagtgctgtatggagtta
gacagggactccccacaggagaaggcgagtagtgtgagtgagatgagtaaacagacagcc
acgccaagggaagagacgcaggccgctaaatcccctactgtgtctcaagatgctcccgat
gcaattagggatgcaagcaaaggattgccacaaagcactctgtcctccatggaccagggc
acagtgcttaacagtcctccagggaagcctgaggactcagccaacgctgatggtcagtct
gtgggaaccccagcaggaacagacactggagcggagaaggacggggctgaggaagaagag
gaggaggactttgatgacctcacccaagatgaagaagatgaactgtcctcagcttctgag
gagtctgtactttctgtcccagagctccaggaaacaatggagaaactgacttggttggca
tctgaaaggcggatgagtcaggagggtgagtctgaggaggagaactcccaggaggagaac
tctgagccagaagaagaggaggaagaggaggcagagggaatggaaaccttgcaaaaagag
gatgaagcgaccgatgaagcaggtggaggtgctgctgagaaacccccgtctaccttggcc
tcacctcacactgctccagaagtagagaccagcataaccccagcaggggagagcatcaaa
gctgctgggaagggacggagcagtcatcgggctcggagcagacggggaagtcgggcccgg
gccagcaaggacgcctccaagctgctgttgctgtacgacgaggacattcttgaccgggac
ccactcagggagcagaaggacctggcgttcgcacaggcttacctaaccagggtgcgagaa
gccctccagcatatccctggcaaatatgaagatttccttcagatcatctatgaatttgag
tcaaatgcccaaatgcacagcgctgtggatctcttcaaaagcttgcaaactcttctccac
gactggcctcagctcttgaaggactttgctgctttcctgctgcctgagcaggccttgtcc
tgtggactcttcgaggagcaacaggcttttgagaagagtcgcaagttccttcgacagctg
gagatatgttttgcagagaacccgtcgcaccaccagaagatcatcaaggttcttcagggc
tgtgcagactgccttcctcaggacatcactgagctcaagacacagatgtggcagcttctc
agaggccatgaccacctacaggatgagttctccatcttttttgatcatctgcgcccagca
gctaacaggatgggtgactttgaagagatcaattggactgaagagaaagagtatgagttt
gatggctttgaagaagtgatactccctgaggtggaagaggaagaagagcctgccaaggtg
tccacagcctccaagagtaagaggcggaaagagattggggtccagcaccaagataaggag
tcagaatggcctgaagcagccaaggatggttcctgtccctgccatgagggtggcccggaa
tctaagctgaagaagagcaaaaggagaaattgtcactgcagcagcaaggtctgtgacagt
aaatcctacaagagcaaggagcccctcgagttggtgggcagtggccccctccaagaggcc
agtactgtgcccggcactaaggaggcgggacaaggcaaggacatgtcagaagaggagacc
atggaggggcaagagaacgtggaggtgagccagaataagactggcaggaccaccagaaag
ggagaggcacccattccagggtcaacagtacggactgctttgctgtgctctgcagaagtg
actcccatcgagctgtccttggagggccccacatgctgctcaccagagactcctcggctt
cctcctcagactggagctgtagtctgttctgtcaggagaaaccaggctgggcctgaagtc
gtctcctgccttggtacatcctccatccctcctaaagagggggaggaccaaaaggctgtg
gctaactcagagactattgcacccctcccagaaacatcagaaactgagagactgccggga
actgtggaactccctgctcccctccccagtcctgtttccttaagtaccagagacactggg
agaagacacatatatgggaaagcaggcactcagagttggctactcgacaatagagctgag
gcaaaggcagcccatatggtggcccctatccgtggaacttcatcaggagctagtgcctca
gaggctgctcccacagcttccagagagggcctagctgaggacagtgaaacacaaggcaag
ggcccggaagcggtgctgccaaaagcctcagaagctaccgtctgtgccaacaatagcaag
gtcagctccacgggggagaaggtggtactttggacaagggaagccgaccgggtgattctc
accatgtgccaggagcagggagcacagcctcacaccttcagtgttatttctcagcagctg
ggaaataagacccctgttgaggtttcccaccgtttccgagagctcatgcagctcttccac
acagcctgtgaggccagctctgaggatgaggatgatgccaccagcaccagcaatgcagac
cagctctccgaccatggagatctgctgtctgaagaggagctggatgagtga

DBGET integrated database retrieval system