KEGG   Rattus norvegicus (rat): 499658
Entry
499658            CDS       T01003                                 

Gene name
Pglyrp3
Definition
(RefSeq) peptidoglycan recognition protein 3
  KO
K01446  peptidoglycan recognition protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Amidase_2
Other DBs
NCBI-GeneID: 499658
NCBI-ProteinID: NP_001178890
RGD: 1593164
Ensembl: ENSRNOG00000046881
UniProt: A0A0G2QC26
Position
2q34
AA seq 339 aa
MLCRLLAFSALSLVACGSPTIVSRKVWGASSLTCRVPLSLPVPYLIIEQVTRMQCQDQTS
CSQVLRVLHSHYVHNKGWCDVAFNFLVGNDGKVYEGVGWHVQGLHTQGYNNVSLGIAFFG
SKIGSSPSPAALSATEDLIFFAILNGYLSPKYIQPFLLKEETCLVPQHSEIPKKACPNII
PRTAWEARETHCSQMNLPAKFVIIIHTAGESCNESADCLIRVRDTQSFHMDKQDFCDIAY
HFLVGQDGVVYEGVGWTIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLEAAQSLIQCAV
AMGYLASNYLLMGHSDVSNILSPGQALYNIIKTWPHFKH
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgctgtgcaggcttcttgccttctctgctctgagtcttgtggcctgtggcagtcctacc
atagtttcccgaaaagtgtggggagcaagttcactcacctgcagagtcccactgagcctg
cctgtgccctacctcatcatagagcaggttaccaggatgcaatgccaagatcagacctcg
tgcagccaggttttgcgggttctacactcccattatgtccacaacaaaggctggtgtgat
gtggctttcaacttcctggttgggaatgatggcaaggtgtatgaaggtgtcggttggcat
gtccaaggtttgcacactcaaggctacaataatgtttccctgggcattgccttctttggc
agtaagataggaagcagccccagtcctgctgctctatcagctacagaggacctgatcttc
tttgccatcctgaatggctacctgtcacccaagtacattcagccatttcttttaaaagaa
gaaacctgtttggttcctcaacactcagagatacccaaaaaagcatgccccaatatcata
ccacggactgcttgggaagccagagagacacattgctctcagatgaaccttccagccaaa
tttgtcatcatcatccacactgctggagaaagctgcaatgaatctgcagactgcttgatt
cgtgtgagagacacacagtcctttcacatggacaaacaagatttctgtgacattgcatat
cacttcctagtgggtcaagatggtgtagtatatgaaggagttggctggactattgaaggc
tctcacacctatggatacaatgatattgctcttggaattgcctttatgggaaactttgta
gaaaagcctccaaatgaagcttcactggaggcagcccagagcctgatccagtgtgctgtg
gccatggggtacctggcctccaactacctgctaatgggccacagtgatgtgtccaacatc
ctgtcccctggacaagcactatacaacatcatcaagacatggcctcacttcaagcactga

DBGET integrated database retrieval system