KEGG   Rattus norvegicus (rat): 499677Help
Entry
499677            CDS       T01003                                 

Gene name
Lix1l
Definition
(RefSeq) limb and CNS expressed 1 like
  KO
K16673  LIX1-like protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LIX1 Dicer_dimer
Motif
Other DBs
NCBI-GeneID: 499677
NCBI-ProteinID: NP_001019474
RGD: 1593161
Ensembl: ENSRNOG00000021213
UniProt: Q5PQQ7
Position
2q34
AA seq 338 aa AA seqDB search
METMRAQRLQPGVGVGGRGTLRALRPGVTGAPTSAATPPAGPPPAPPPPAPPPPPLLLAG
APGLPLPPGATGSPAVLREAVEAVVRSFAKHTQGYGRAVNVVEALQEFWQMKQSRGADLK
NGALVVYEMVPSNSPPYVCYVTLPGGSCFGSFQFCPTKAEARRSAAKIALMNSVFNEHPS
RRITDEFIEKSVSEALASFNGNREEADNPNTGIGAFRFMLESNKGKSMLEFQELMTVFQL
LHWNGSLKAMRERQCSRQEVLAHYSHRALDDDIRHQMALDWVSREQSVPGALSRELASTE
RELDEARLAGKELRFHKEKKDILMLAAGQLGNMHSSSC
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggagactatgcgagcacagcggctgcagcccggcgtaggtgtcggcgggagaggcact
ctacgagcactgaggccgggggtgaccggggccccaactagcgccgccacaccccccgca
ggcccgccgcccgccccaccgccccccgccccgcccccgccgccactgcttctggctggg
gcccccgggctgcccctgccccccggcgctacggggagcccggcggtgctgcgcgaggcg
gtggaggcggtggtgaggagcttcgccaagcacacgcagggctatggtcgagcagtgaac
gtggtggaggcccttcaggaattctggcagatgaagcagtctcggggcgctgacctgaag
aacggggctctggtggtgtacgagatggtcccctccaacagccctccctacgtctgctat
gttactctgcctggggggagttgcttcgggagtttccagttttgccccacaaaagctgag
gcccggcgaagtgctgcaaagattgcattaatgaactccgtgtttaatgagcatccatcc
cgaagaattactgatgaatttattgagaagagtgtctcagaggccctggcatctttcaat
ggtaacagagaggaagccgacaacccaaacacggggattggtgccttccgattcatgctg
gaatctaacaagggcaagtcaatgctggaattccaggagctgatgacagtttttcagctg
ttgcactggaatggcagccttaaggccatgagagaaagacagtgctctcgacaggaggtg
ttggctcattattcacatcgggccttagatgatgacattcgccaccaaatggctttggac
tgggtgagccgggagcagagtgtgccaggggcactgtcaagagagctggcttccactgaa
cgggagctcgatgaagccaggctggcgggcaaggagttgcgcttccacaaggagaagaaa
gacattctcatgctggctgctgggcagttgggcaatatgcattcttccagctgttaa

DBGET integrated database retrieval system