KEGG   Rattus norvegicus (rat): 499690Help
Entry
499690            CDS       T01003                                 

Gene name
Tmem167b, RGD1564454
Definition
(RefSeq) transmembrane protein 167B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1242 LST1
Motif
Other DBs
NCBI-GeneID: 499690
NCBI-ProteinID: NP_001128732
RGD: 1564454
Ensembl: ENSRNOG00000042160
UniProt: D3ZSX4
Position
2q34
AA seq 74 aa AA seqDB search
MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVA
IACIVMAFYVLFIK
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgtgtactccttggatgggattctggtgtttggtctgctctttgtttgcacc
tgtgcctacttcaagaaagtacctcgtctcaaaacctggctgctttcagagaagaaggga
gtttggggtgtattttacaaagctgctgtgattggaacccggctgcatgctgctgttgca
attgcctgcatcgtaatggccttttacgtcctgtttatcaaatga

DBGET integrated database retrieval system