KEGG   Rattus norvegicus (rat): 499709Help
Entry
499709            CDS       T01003                                 

Gene name
Gar1, Nola1
Definition
(RefSeq) GAR1 ribonucleoprotein
  KO
K11128  H/ACA ribonucleoprotein complex subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    499709 (Gar1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    499709 (Gar1)
   03032 DNA replication proteins [BR:rno03032]
    499709 (Gar1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Sno RNPs
   Box H/ACA snoRNPs
    499709 (Gar1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     499709 (Gar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gar1
Motif
Other DBs
NCBI-GeneID: 499709
NCBI-ProteinID: NP_001019477
RGD: 1563995
Ensembl: ENSRNOG00000061146
UniProt: Q6AYA1
Position
2q43
AA seq 226 aa AA seqDB search
MSFRGGGRGGFNRGGGGGGFNRGGGSNNHFRGGGGGGGGGGNFRGGGRGGFGRGGGRGGF
NKFQDQGPPERVVLLGEFMHPCEDDIVCKCTTEENKVPYFNAPVYLENKEQIGKVDEIFG
QLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGGGGGGG
RGGRGGGRGGGGRGGGRGGGFRGGRGGGGGFRGGRGGGGGFRGRGH
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccgaggcggaggtcgcggaggctttaatcgcggtggtggaggtggaggcttc
aatcgtggcggcggcagcaacaaccacttccgagggggcggcggcggtggtggcggcggc
ggcaatttcaggggcggcggccgaggaggatttggacgagggggcggtcgtggaggcttc
aataaattccaagatcaagggcctccagaacgagtcgtcttattaggagagttcatgcat
ccctgtgaagatgacatcgtttgtaaatgtaccacagaagaaaacaaggtgccttacttc
aatgctcctgtttatttagaaaacaaagaacaaatcgggaaagtggatgaaatatttgga
caacttagagatttttatttttcagttaaattgtcagaaaacatgaaggcatcttctttt
aaaaagctacagaagttttacatagacccatataagctgctgccactgcagaggtttctg
cctcggcctcctggtgagaaaggacctcccagaggtggtggcggtggaggtggtggtggc
aggggaggtcgaggaggaggaagaggaggcggtggccgaggtggtggaagaggtggtggt
tttagaggtggaagaggaggaggtgggggcttcagaggaggaagaggaggaggcggcgga
ttccgaggaaggggacattag

DBGET integrated database retrieval system