KEGG   Rattus norvegicus (rat): 499744
Entry
499744            CDS       T01003                                 

Gene name
Il36g, Il1f9, RGD1563019
Definition
(RefSeq) interleukin 36, gamma
  KO
K05487  interleukin 36 gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    499744 (Il36g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    499744 (Il36g)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   499744 (Il36g)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 499744
NCBI-ProteinID: NP_001107262
RGD: 1563019
Ensembl: ENSRNOG00000005701
UniProt: B0BMY4
Position
3p13
AA seq 165 aa
MSSKYPHSPCTASAGKETPDLGQVSDVDQQVWIFRDQALVTVPRSHTVTPVTVTVLPCKY
PESLEQGKGTPIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILNLYHHPEPMKPFLFYHTL
TGATSTFESVVFPGSFIASSKIGKPIFLTSKKGEHYNIHFSLDII
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtcctctaaatacccacattctccatgtactgcctcagcaggaaaagaaactcctgac
cttgggcaggtttctgatgtggatcagcaggtgtggatctttcgtgatcaggcccttgtg
acagttccacgaagccacactgtaactccagtcactgtgactgtcctcccatgcaagtac
ccagagtctcttgagcagggcaaagggactcccatttatttgggaattcaaaatccagat
aaatgcctgttttgtaaggaagttaatggacaccccactttgctcctgaaggaagagaag
attttgaatttgtaccaccatcctgagccaatgaagccattcctgttttaccacaccctg
acaggtgcaacgtccacctttgaatcagtggttttccctggcagctttattgcctcctcc
aagattggcaaacccatcttcctcacatcaaaaaagggagaacattacaacattcacttc
agtttagatataatttag

DBGET integrated database retrieval system