KEGG   Rattus norvegicus (rat): 499745Help
Entry
499745            CDS       T01003                                 

Gene name
Nrarp
Definition
(RefSeq) Notch-regulated ankyrin repeat protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank
Motif
Other DBs
NCBI-GeneID: 499745
NCBI-ProteinID: NP_001137222
RGD: 1591939
Ensembl: ENSRNOG00000009354
UniProt: D3Z9S9
Position
3p13
AA seq 114 aa AA seqDB search
MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVI
DGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccgagctgtccacctgctcggcgccacagacgcagcgcatcttccaggaa
gcggtgcgcaagggcaacacacaggagcttcagtcgctgctgcagaacatgactaactgc
gaattcaacgtgaactcgttcgggccggagggccagacagcactacaccagtcagtcatc
gacggcaacctggagctggtgaagctgctagtcaaattcggcgcagacatccgcctagcc
aaccgcgacggctggagcgcactgcacatcgccgctttcgggggccaccaggacatcgtg
ctctatctcatcaccaaggccaagtacgcggccagcggccggtga

DBGET integrated database retrieval system