KEGG   Rattus norvegicus (rat): 499768
Entry
499768            CDS       T01003                                 

Gene name
Tbc1d13
Definition
(RefSeq) TBC1 domain family member 13 isoform X1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: RabGAP-TBC TFIID_20kDa Zincin_2
Other DBs
NCBI-GeneID: 499768
NCBI-ProteinID: XP_575106
RGD: 1591937
Ensembl: ENSRNOG00000015970
UniProt: D4AEG7
Position
3
AA seq 400 aa
MSSLHKSRIADFQDVLKEPSIVLEKLRELSFSGIPCEGGLRCLCWKILLNYLPLERDSWD
SILAKQRGLYSQFLREMIIQPGIAKANMGVSREDVTFEDHPLNPNPDSRWNTYFKDNEVL
LQIDKDVRRLCPDISFFQRATEYPCLLILDPQNEFETLRKRVEQTTLKSQTVARNRSGVT
NMSSPHKNNAPSALNEYEVLPNGCEAHWEVVERILFIYAKLNPGIAYVQGMNEIVGPLYY
TFATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSLDDSQCGITYKMEKVYSTLKEKDV
ELYLKLQEQSIKPQFFAFRWLTLLLSQEFLLPDVIRIWDSLFADGNRFDFLLLVCCAMLI
LIREQLLKGDFTVNMRLLQDYPISDVCKILQKAKELQDSK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgtcgagtctgcacaagagccggattgcagatttccaggatgtcctgaaggagccctcc
attgtgttggaaaagcttcgagaactcagttttagtggcatcccctgtgagggcggactg
cggtgcctctgctggaagatcctcctgaactacctccctttggagagagactcgtgggat
tccatcctggccaagcagagggggctttattcacagttcctgagagagatgattattcag
cctggcattgcgaaggccaacatgggtgtgtccagagaggacgtgacctttgaggaccat
cccctgaacccaaaccctgacagcaggtggaacacgtattttaaggacaacgaggtgcta
ttgcagattgacaaagatgtccggaggctgtgcccagatatatccttcttccaaagagcc
actgagtacccctgcctcctcatcctggacccgcagaatgagtttgagacccttcgtaag
cgtgtggagcagacgacactgaagtctcagacggtggcccggaaccgaagcggggtcaca
aatatgagctccccgcacaagaacaatgcaccatcagccctgaacgagtatgaggttcta
cccaatggctgcgaagcccactgggaggtggtggagcggatcctgttcatctatgccaag
ctcaaccctggcatcgcttatgtgcagggcatgaatgagatcgtgggccccctctactac
acttttgccactgaccctaacagcgagtggaaagagcacgctgaagcagatacctttttc
tgcttcaccaacctcatggccgagatacgggacaacttcatcaagagcctggatgactcc
cagtgcggcatcacctacaagatggaaaaggtgtactccaccttgaaggagaaggacgtg
gagctctacctgaagctgcaagaacagagtatcaagcctcagttctttgccttccgatgg
ctgacactactgctgtcccaggagttcttgttacctgatgtcatccggatatgggactcc
ctctttgctgatggcaaccgcttcgatttcctcctcctggtctgctgtgctatgctcata
ctgatccgggagcagttgctgaagggggacttcactgtcaacatgcggcttctgcaggat
taccccatctcagatgtctgcaagatcttacagaaagccaaggaactccaagactcgaag
taa

DBGET integrated database retrieval system