KEGG   Rattus norvegicus (rat): 499798Help
Entry
499798            CDS       T01003                                 

Gene name
Arl6ip6
Definition
(RefSeq) ADP ribosylation factor like GTPase 6 interacting protein 6
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ARL6IP6 CbtA DUF1129 ETRAMP
Motif
Other DBs
NCBI-GeneID: 499798
NCBI-ProteinID: NP_001019481
RGD: 1564819
Ensembl: ENSRNOG00000005074
UniProt: Q68FV2
Position
3q12
AA seq 223 aa AA seqDB search
MSFVESWRSVGPRRRRQVTPGPVTRSVYSDYTQGNSWSEDGDEGCDQVARDLRAEFSARA
SSESKRAPLLPRIGDGSPVLPDKRNGIFPATAAKRTQARRWPIQALSILCSLLFAVLLAF
LLAIAYLIVKELHTENSKNEDVVDTGLLGFWSLLIISLTAGLSCCSFSWTVTYFDSFEPG
MFPPTPLSPARFKKLTGHSFHMGYSMAILNGVVAALTVAWCLM
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttgtggagagttggaggtctgtaggcccgcgtaggcgccgtcaggttacccca
ggccctgtcactcggtctgtgtattccgactacactcaagggaatagctggagtgaggac
ggagacgagggatgcgaccaagtggcccgcgacttgcgagcagagttctcggccagggcg
tcgtcggagtccaagagggctccgctactcccacggatcggggacgggtcgccggtcctg
ccggataagcgcaacggcatcttcccggcgactgcggccaagcgaacccaggctcggcgg
tggcccatccaagccctttccattctttgttcgctgctgttcgccgtcctccttgctttt
ctcctcgccatcgcctacctgatcgttaaagaattgcatacagaaaactcgaaaaatgaa
gatgtcgtagatacggggctgttaggattctggtctctgctgataatatctctaactgct
ggattatcctgttgcagcttttcttggacagtgacttactttgattcttttgaaccagga
atgtttccgcctactcctctttcacctgctaggttcaagaaactgactggacattctttc
cacatgggctacagcatggcaattctgaatggtgttgtagctgctctcactgtggcatgg
tgccttatgtaa

DBGET integrated database retrieval system