KEGG   Rattus norvegicus (rat): 499839Help
Entry
499839            CDS       T01003                                 

Gene name
RGD1564664, Ag2
Definition
(RefSeq) similar to LOC387763 protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4695
Motif
Other DBs
NCBI-GeneID: 499839
NCBI-ProteinID: NP_001103525
RGD: 1564664
Ensembl: ENSRNOG00000055564
UniProt: A8IHN8
Position
3q31
AA seq 242 aa AA seqDB search
MAFAVIRACSRVGRGGLYKRLGGLPRGTRRQRQRRQGASLSTTEQRSLAPRPPTGPPARY
PSPAVPARASEARRHPAADLDPPPGEPQAVASRGTPEPRPPPESPGAQPPPGPAAADGAM
AAAKPGELMGISSSYQAVMPHFVCLADEFPQPVRPAKLPKGKGRLRRPRQSRFKTQPVTF
DEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREPLGSCKLRNSLDSSDSDS
AL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgctgtcatccgagcttgcagccgtgtgggcagaggcgggctatataagcgg
ctaggcgggctgccgcggggcacacggcgacagagacagcggcggcagggagcctctctg
agcaccaccgagcagcgcagcttagccccgcgtcccccgacgggcccgcccgcccgctat
ccctctccagcagtgccggctcgggccagcgaggcccgccgccaccccgcagcagatttg
gatcccccgcccggagagccccaggctgtcgcctcccgggggaccccggagccgcggccg
cccccggagagcccgggcgcccagccgccccccggccccgcagccgccgacggcgccatg
gcggccgccaagcccggcgagctcatgggcatctcttctagctaccaagcggtgatgcca
cacttcgtgtgcctggccgatgagttcccgcagccggtgcggcccgccaagctgcccaag
ggcaagggccggctgcggcgaccgcgccagtcccgcttcaagacgcagccggtgaccttc
gatgagatccaggaggtggaggaggagggggtgtccccgatggaggaggaaaaggccaag
aagtcgttcctgcagagcttggaatgcctgcgccgcagcacgcagagcctgtcgctgcag
agggagccgctcggtagctgcaaactgaggaacagcctggactccagcgactccgactcg
gcgctgtga

DBGET integrated database retrieval system