KEGG   Rattus norvegicus (rat): 499870
Entry
499870            CDS       T01003                                 

Gene name
Rad51, RGD1563603
Definition
(RefSeq) RAD51 recombinase
  KO
K04482  DNA repair protein RAD51
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03440  Homologous recombination
rno03460  Fanconi anemia pathway
rno05200  Pathways in cancer
rno05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    499870 (Rad51)
   03460 Fanconi anemia pathway
    499870 (Rad51)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    499870 (Rad51)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    499870 (Rad51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    499870 (Rad51)
   04121 Ubiquitin system [BR:rno04121]
    499870 (Rad51)
   03400 DNA repair and recombination proteins [BR:rno03400]
    499870 (Rad51)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    499870 (Rad51)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    499870 (Rad51)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     499870 (Rad51)
    RecA family proteins
     499870 (Rad51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     499870 (Rad51)
SSDB
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase HHH ssDNA_TraI_N
Other DBs
NCBI-GeneID: 499870
NCBI-ProteinID: NP_001102674
RGD: 1563603
Ensembl: ENSRNOG00000037302
UniProt: B5DF04
Position
3q35
AA seq 339 aa
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGYHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggctatgcaaatgcagcttgaagcaaatgcagatacttcagtggaagaagaaagcttt
ggtccacagcctatttctcggttagagcaatgtggcataaatgccaatgatgtgaagaaa
ttagaagaagctggttaccacacggtggaggctgttgcttatgcaccaaagaaggaactg
ataaatattaaaggaattagtgaagccaaagctgacaaaatcctggctgaggcagcgaaa
ttagttccaatgggtttcaccactgcaaccgaatttcaccaacgccggtcagaaatcatc
cagattactactggctccaaagagcttgacaaactacttcaaggtggaattgagactggg
tctatcacagagatgtttggagaattccgaactgggaagacacagatctgtcatacattg
gctgtaacatgccagctccccattgaccgaggtggaggtgaagggaaagcaatgtacatt
gacaccgagggcacctttaggccggagcggctgctggcggtagctgagagatacggcctc
tctggaagtgacgtcctcgataatgtagcatacgctcgagggttcaacacagaccaccag
acccagctcctttaccaagcgtcagccatgatggtagaatccaggtatgcactgcttatt
gtagacagtgctactgccctttacagaacagactactcaggtcggggagagctttcagcc
aggcaaatgcatttggccagatttctaaggatgctgcttcgacttgctgatgagtttggt
gtagcagtggtaatcaccaaccaggtggtagcccaagtggatggagcagccatgtttgct
gcagatccgaaaaaacccattggaggaaacatcatcgctcatgcatcaaccaccaggcta
tacctgaggaaaggaagaggggaaaccagaatctgcaaaatctacgactctccctgtctc
cctgaagctgaagccatgtttgccattaatgcagatggagtgggagatgccaaagactga

DBGET integrated database retrieval system