KEGG   Rattus norvegicus (rat): 499871Help
Entry
499871            CDS       T01003                                 

Gene name
Zfyve19
Definition
(RefSeq) zinc finger FYVE-type containing 19
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE zf-B_box Rpr2
Motif
Other DBs
NCBI-GeneID: 499871
NCBI-ProteinID: NP_001030120
RGD: 1561576
Ensembl: ENSRNOG00000012528
UniProt: Q499R6
Position
3q35
AA seq 386 aa AA seqDB search
MESRCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTVLTRG
SSDTASKWSPPQNYKKRVAALEAKKKSSASQSQGLTHKDQAIAERLARLRQENKPKSIPS
QAEIEARLAALKDEVQGPIPSTQEMEDRLAALQGRAPPPHTMRPVHQAPDTRTQAQQTQD
LLTQLTAEVAIDENWQPRVSAPPQNSLNKGGTRNQHTDSQGQASLEEEKNKLLAEASVEL
QEENTRQERILALARRLAVLKGQDPSRVTLQDYHLPDSDEDEDEETAIRRVLQQLTEEAA
LDEASGFNIPEEPAPASQAQPHKAKTEAEEEELPWCCICNEDATLRCAGCDGDLYCARCF
REGHDNFDLKEHQTSPFHPRPPCREH
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaggtgctacggctgtgctgtcaagttcaccctcttcaagaaggagtacggc
tgtaagaactgtggccgagccttctgtaatggctgtcttagcttcagcgcactggtaccc
cgggctggcaacacacaacagaaagtctgcaagcagtgccacacagtcctgaccagaggg
tcttctgacactgcctccaagtggtcgccacctcagaactataagaaacgcgtggcagcc
ttggaagccaagaaaaagtccagcgcttcccagagccaaggcctgacccacaaagaccaa
gccattgctgagcgtctggcacggcttcgtcaggaaaacaagcccaagtcaataccctca
caggcagagatagaggcgcggctcgccgcactgaaggatgaagtccagggccccatccct
tccacacaggaaatggaggatcggcttgcagcactgcagggcagagccccacctcctcac
accatgagaccggtacaccaggcaccagataccaggacccaggcccagcagacacaggat
ctgctcacacagttgacagctgaggtggccattgatgaaaactggcaaccaagagtctca
gcccctccccagaacagcctcaacaagggaggtacaaggaaccagcacacagattcccag
gggcaggcgtctctggaggaagagaagaacaagctgctggctgaggcatcagttgagcta
caggaggagaacaccaggcaggagcggatcctggctcttgccagaagattggctgtacta
aagggacaggaccccagcagagtaacccttcaagactatcacctcccagacagtgacgag
gatgaggatgaagagacagccatccggagagtcctgcagcagctcactgaagaagcagct
ctggatgaggcaagtggctttaacatccctgaggaaccagctccagcatcccaggctcaa
ccccacaaggccaagactgaggctgaggaagaagaactcccctggtgctgtatctgcaat
gaggatgctactctgcgctgtgctggctgtgatggagacctctactgtgcccggtgcttc
cgggagggccacgataactttgatcttaaagaacatcagacttctcccttccacccccga
ccgccttgccgagaacactga

DBGET integrated database retrieval system