KEGG   Rattus norvegicus (rat): 499877
Entry
499877            CDS       T01003                                 

Gene name
Ubr1, RGD1562326
Definition
(RefSeq) ubiquitin protein ligase E3 component n-recognin 1
  KO
K10625  E3 ubiquitin-protein ligase UBR1 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    499877 (Ubr1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     499877 (Ubr1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    499877 (Ubr1)
SSDB
Motif
Pfam: PRT6_C zf-UBR ClpS
Other DBs
NCBI-GeneID: 499877
NCBI-ProteinID: NP_001171543
RGD: 1562326
UniProt: D5MTG9
Position
3q35
AA seq 1757 aa
MADEEMDGAERMDVSPEPPLAPQPPASWWDQQGDFYTAFLHHLAKLVPEIYFAEMDPDLE
KQEENVQMSIFTPLEWYLFGEDPDVCLERLKHSAAFQLCGKVFKSGETTYSCRDCAIDPT
CVLCMDCFQSSVHKNHRYKMHTSTGGGFCDCGDTEAWKTGPFCMDHEPGRAGTTKETLHC
PLNEEVIAQARRIFPSVIKYIVEMTIWEEEKELPPELQRREKNERYYCVLFNDEHHSYDH
VIYSLQRALDCELAEAQLHTTAIDKEGRRAVKAGVYSACQEAKEDIKSHSENVSQHPLHV
EVLHSVVMAHQKFALRLGSWMNKIMSYSSDFRQIFCQACLIEEPGSEHPCLISRLMLWDA
KLYKGARKILHELIFSSFFMEMEYKKLFAMEFVKYYKQLQKEYISDDHERSISITALSVQ
VFTVPTLARHLIEEQNVISVITETLLEVLPEYLDRNNKFNFQGYSQDKLGRVYAVICDLK
YILISKPLVWTERLRAQFLEGFRSFLKILTCMQGMEEIRRQVGQHIEVDPDWEAAIAIQM
QLKNILLMFQEWCACDEDLLLVAYKECHKAVMRCSTNFMSSTKTVVQLCGHSLETKSYKV
SEDLVSIHLPLSRTLAGLHVRLSRLGAVSRLHEFVPFDGFQVEVLVEYPLRCLVLVAQVV
AEMWRRNGLSLISQVFYYQDVKCREEMYDKDIIMLQIGASIMDPNKFLLLVLQRYELADA
FNKTISTKDQDLIKQYNTLIEEMLQVLIYIVGERYVPGVGNVTKEEVIMREITHLLCIEP
MPHSAIARNLPENENNETGLENVINKVATFKKPGVSGHGVYELKDESLKDFNMYFYHYSK
TQHSKAEHMQKKRRKQENKDEALPPPPPPEFCPAFSKVTDLLNCDIMMHILRTIFERAVD
PESNLWTEGMLQMAFHILALGLLEEKQQLQKAPEEEVAFDFYHKASRLGSSAMNAQNIQM
LLEKLKGIPQLEGQKDMITWILQMFDTVKRLREKSCLVVASTSGLESIKSEEITHDKEKA
ERKRKAEAARLHRQKIMAQMSALQKNFIETHKLMYDNTSEITGKEDSIMEEESPSAVSEC
SRIALGPKRGPALTEKEVLTCILCQEEQEVKLENNAMVLSACVQKSTALTQHRGKPAGLL
GESLDPLFMDPDLAHGTYAGSCGHVMHAVCWQKYFEAVQLSSQQRIHVDLFDLESGEYLC
PLCKSLCNTVIPIIPLQPQKINSENAEALSQLLTLARWIQTVLARISGYNMKHAKGEAPA
VPVLFNQGMGDSTFEFHSILSFGVQSSVKYSNSIKEMVILFATTIYRIGLKVPPDELDPR
VPMMTWSTCAFTIQAIENLLGDEGKPLFGALQNRQHNGLKALMQFAVAQRTTCPQVLIQK
HLVRLLSVVLPNLQSENTPCLLSVDLFHVLVGAVLAFPSLYWDDTVDLQPSPLSSSYSHL
YLFHLVTMAHMLQILLTVDADQSPGLPLNEGGEDSEEARCASALFVEVSQHTDGLIGCGA
PGWYLWLSLRNGITPYLRCAALLFHYLLGVTPPEELFANSAEGEFSALCSYLSLPTNLFL
LFQEYWDTIRPLLQRWCGDPALLNSLKQKSALVRYPRKRNSLIELPDDYSCLLNQASHFR
CPRSSDDERKHPVLCLFCGAILCSQNICCQEIVNGEEVGACVFHALQCGAGVCIFLKIRE
CRVVLVEGKARGCAYPAPYLDEYGETDPGLKRGNPLHLSRERYRKLHLVWQQHCIIEEIA
RSQETNQMLFGFNWQLL
NT seq 5274 nt   +upstreamnt  +downstreamnt
atggcggacgaagagatggacggcgccgagaggatggacgtcagcccggagcctcccctg
gcccctcagccgcccgcatcctggtgggatcagcaaggtgatttttatactgctttctta
catcatttggcaaaattagtgccagaaatttattttgctgagatggacccagatttggaa
aagcaagaagagaatgtacaaatgtcaatattcactcctttggaatggtacttatttgga
gaggatccagacgtttgcttagagagattaaagcacagtgcagcatttcagttgtgcggg
aaggttttcaaaagtggagaaacaacatattcctgtagggattgtgcaattgatccaacg
tgtgtgctctgtatggactgcttccagagtagtgttcataaaaaccatcgttacaagatg
catacttctactggaggaggcttctgtgactgtggagacacagaagcgtggaaaactggt
cccttttgtatggatcacgaacctggaagagcaggtactacaaaagagaccttgcattgc
ccactgaatgaagaggtaattgctcaagccaggagaatattcccttcagtgataaagtac
attgtagaaatgactatatgggaagaggaaaaggaactgcctcctgaactgcagagaagg
gagaaaaatgaaagatattactgtgtccttttcaacgatgagcaccattcatatgatcat
gtgatatacagtctgcaaagagctcttgactgtgagcttgcagaggcacagttgcacaca
actgccatagacaaagagggtcgccgggctgtcaaagcaggtgtgtattccgcttgccag
gaagcaaaggaggatataaagagtcactcagagaacgtctctcagcaccccctccatgtg
gaagtgctgcattccgtggttatggcccaccagaaatttgctctgcgccttggatcctgg
atgaacaaaattatgagctattcaagtgactttaggcagatcttctgccaagcctgcctc
atagaggagcctggctctgaacatccctgtcttataagcagactaatgctttgggatgca
aaactttataaaggtgcccgtaagatccttcacgaattgatctttagtagtttttttatg
gagatggaatacaaaaaactctttgctatggaatttgtgaagtattataaacaactacag
aaagagtacatcagtgacgaccacgagagaagcatctctataaccgcactgtccgttcag
gtgttcactgtccccaccttggcccgacatcttattgaagagcagaatgttatttctgtc
attactgaaactctgctggaagttctacctgagtacttggacaggaacaataagttcaac
ttccagggctatagccaggacaagctgggaagagtgtacgcggtgatctgtgacctgaag
tacatcctgattagcaagcctctcgtatggacagaaagactaagagcacagttcctggaa
gggttccggtcttttctgaagattctcacctgtatgcagggaatggaagaaatcagaaga
caagttggacagcacattgaagtagaccctgactgggaggctgccatcgctatacagatg
caactaaagaatattttgctcatgttccaagagtggtgtgcttgtgatgaagatctctta
ctagtggcttataaagaatgtcacaaagctgtaatgaggtgcagcacaaatttcatgtct
agtaccaagacagtagtacaactgtgtggtcatagtttggaaactaaatcctacaaagtg
tctgaggaccttgtcagcatacatctaccactctctagaactctcgctggtcttcatgta
cgtttaagcagactaggtgctgtttcaagactgcatgaatttgtgccttttgatggcttt
caagtagaggtcctagtagagtaccctttgcgctgcctggtgctggttgctcaggttgtt
gccgagatgtggcgaagaaacgggctctccctcattagccaggttttctattatcaagat
gttaaatgcagggaagaaatgtatgataaagatatcatcatgcttcagattggagcgtct
ataatggatcccaacaagttcttgttactggtacttcagaggtatgaacttgctgatgct
tttaacaagaccatatccacaaaagaccaggatttgattaaacagtataacacattaata
gaagaaatgcttcaggtcctcatctatattgtgggagaacgttatgtacccggagtggga
aacgtgaccaaagaggaggttataatgagagagatcactcacttactttgcattgagccc
atgccacacagtgccattgccagaaacctaccggagaatgaaaataacgaaactggctta
gagaatgtcataaacaaagtggccacatttaagaaaccgggtgtgtcgggccatggtgtt
tatgaattgaaagacgaatcactgaaagacttcaatatgtacttttaccattattctaaa
acacagcatagcaaggctgaacatatgcagaagaagaggagaaaacaagaaaataaagat
gaagccttgccaccgccacctcctcctgagttctgtcccgctttcagcaaagtaactgac
cttctcaactgtgatattatgatgcacattctcaggaccatcttcgagcgggcagtggac
cccgagtctaatctgtggacagaagggatgctccaaatggccttccatatattggcgctg
ggcttgctggaggagaagcagcagcttcagaaagctcctgaagaagaagtggctttcgac
ttttaccataaggcttcaagattgggaagttcagcaatgaatgctcagaatatacaaatg
cttttggaaaaactcaaaggaatcccccaattagaaggccagaaggacatgataacatgg
attctccagatgtttgacacagtgaagcgattaagagaaaaatcttgtttagttgtggca
agcacttcaggattggagtccattaaaagtgaggagattactcatgataaagaaaaagca
gaacggaagagaaaagctgaagctgctaggctacatcgccagaagatcatggcccagatg
tctgccttacagaaaaacttcattgaaactcacaaactcatgtatgacaatacatcagaa
ataacagggaaggaagactccattatggaagaagaaagcccctcagcagtcagtgagtgc
tctcgaattgctctgggccctaaacggggcccagctcttacagaaaaggaggtgctgacg
tgcatcctctgccaagaagaacaagaggtgaaactagaaaacaacgccatggtgttgtcc
gcctgtgtgcagaaatccaccgccctaacccagcacagggggaagcctgcgggcctctta
ggggaatcactggaccctcttttcatggatccagacctggcacatggcacttacgcagga
agctgtggtcatgtaatgcatgcagtgtgctggcagaagtattttgaagcagtgcagctg
agctctcagcagcgcattcacgtcgacctgtttgacttggagagtggagagtacctgtgc
cctctctgcaagtctctctgcaataccgtcatccccatcattcctttgcagccacagaag
atcaacagtgagaatgcagaggctctttctcaacttttgaccttggcacggtggatacag
actgtccttgcaagaatatcaggttataatatgaaacacgctaaaggagaagctccagca
gttcctgtcctgtttaatcaaggaatgggggattctacttttgagtttcattccatcctg
agttttggagttcagtcttcggtgaaatactcaaatagtatcaaggaaatggtcattctc
tttgccacaacaatttacagaatcggcctgaaagtgcctcctgatgaattagacccacga
gtacccatgatgacctggagcacgtgtgctttcaccatccaggcaattgaaaaccttttg
ggagatgaaggaaaacctctatttggagcacttcaaaatagacagcataatggtctgaaa
gcgttaatgcaatttgcagttgcacagaggactacctgtcctcaggtcctgatacagaaa
catctggttcgactcctatcagttgttcttcctaacctacaatcagaaaatacaccatgc
cttctatccgttgatctatttcatgttctggtgggcgctgtcttagcgttcccgtccttg
tactgggatgacacggtggatctgcagccttcaccgctcagctcttcatacagccacctt
tatctcttccatctggtcaccatggcccatatgcttcagatactcctcacggtagatgca
gatcagtctccgggactcccacttaatgagggtggagaggacagtgaagaggctcgctgt
gcgtctgctctcttcgtggaagtctcacagcacacagacggcctcattgggtgtggtgct
cctggctggtacctgtggctctccctgaggaatggcatcaccccttacctccgctgtgct
gcactgcttttccactatttactcggagtaactccgcctgaagaactgtttgccaactct
gctgaaggagaattcagtgcactctgtagctatctctctttacccacaaatttgttcctg
cttttccaggaatattgggataccataaggcccttacttcagaggtggtgtggagatcct
gccttactcaactctttgaagcagaaaagtgctctggtcaggtaccctagaaaaagaaat
agtttgatagagcttcctgatgactacagctgtcttctaaatcaagcttctcactttagg
tgtccacggtcttcagatgatgaacgaaagcaccctgtcctctgtcttttctgtggggcc
atcctgtgttctcagaacatctgttgccaagaaatcgtgaatggggaggaggttggagcg
tgcgtttttcatgcacttcagtgtggtgctggagtctgcattttcctaaaaatcagagaa
tgcagagtggtcctggtagaaggaaaagccagaggctgtgcctacccagccccttacttg
gatgaatatggagaaacagacccagggctaaagaggggaaacccacttcatttatctcgg
gagcggtatcggaagctgcatttggtctggcaacagcactgcattatagaagagattgct
cggagccaggagactaatcagatgctgtttggattcaactggcagttactctga

DBGET integrated database retrieval system