KEGG   Rattus norvegicus (rat): 499893
Entry
499893            CDS       T01003                                 

Gene name
Ap5s1, RGD1561852
Definition
(RefSeq) adaptor-related protein complex 5, sigma 1 subunit
  KO
K19024  AP-5 complex subunit sigma-1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    499893 (Ap5s1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    AP-5 complex
     499893 (Ap5s1)
SSDB
Motif
Pfam: AP-5_subunit_s1
Other DBs
NCBI-GeneID: 499893
NCBI-ProteinID: NP_001128090
RGD: 1561852
Ensembl: ENSRNOG00000021249
UniProt: D3ZGQ9
Position
3q36
AA seq 169 aa
MVHAFLIHTLRAPNLEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLFRKEQILAVARQ
VESLCRLQQQASGCSSTDPQPQFSAESVSLHEAPHGAFHLAAGDPFQEPQTVLWLGVLSL
GFTLVLDTHENLLLAERTLRLLARLLLDHLRLLTPAVSTGAVYCLPDSP
NT seq 510 nt   +upstreamnt  +downstreamnt
atggtccacgctttcctcatccacacgttaagggccccgaatttggaagatacaggcctt
tgccgagtgctctactcctgtgtctttggtgctgagaaatcacctgatgatccccgacca
catggtgcagaaagggacaggctcttccgaaaggaacagattttggcggtggccagacag
gtggagtcactgtgtaggctgcagcagcaagcatctggatgttcctccacagacccgcag
cctcagttctcagctgagtctgtgtccctgcatgaggcccctcacggagccttccacctg
gcagctggggaccctttccaggagccacagacagtgctatggctgggcgtgctctcctta
ggtttcaccctggtgttggatacccatgagaatctgctgctagctgagcgcacactccgg
ctcttggcccgcctcctccttgaccacctccggctgctgacaccagctgtgagtactgga
gcagtgtactgcctgccagactcaccttag

DBGET integrated database retrieval system