KEGG   Rattus norvegicus (rat): 499903
Entry
499903            CDS       T01003                                 

Gene name
Napb, SNAP-beta, Snapb
Definition
(RefSeq) NSF attachment protein beta
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SNAP TPR_12 Spatacsin_C TPR_7 DUF2150
Other DBs
NCBI-GeneID: 499903
NCBI-ProteinID: NP_001178895
RGD: 1589649
Ensembl: ENSRNOG00000004753
UniProt: F8WFM2
Position
3q41
AA seq 298 aa
MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAANMFKMAKNWSA
AGNAFCQAAKLHMQLQSKHDSATSFVDAGNAYKKADPQEAINCLNAAIDIYTDMGRFTIA
AKHHITIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAAYAAQLEQYQK
AIEIYEQVGANTMDNPLLKYSAKDYFFKAALCHFIVDELNAKLALEKYEEMFPAFTDSRE
CKLLKKLLEAHEEQNSEAYTEAVKEFDSISRLDQWLTTMLLRIKKSIQGDGEGDGDLK
NT seq 897 nt   +upstreamnt  +downstreamnt
atggacaacgcagggaaagaacgagaagcggtccagcttatggcggaggccgagaagcga
gtgaaggcttcccactccttcctccgagggttgttcggaggaaacacaagaatagaagag
gcatgtgaaatgtataccagagctgcaaatatgttcaagatggccaagaactggagtgct
gcaggaaatgcattttgtcaagccgccaagctccacatgcagcttcagagcaagcatgac
tctgctacgagctttgtggatgctggaaatgcttacaagaaagcagaccctcaagaggct
atcaactgcttaaatgcagccatcgacatttacacagacatgggaagattcacaatcgca
gccaagcaccatatcaccattgctgagatctatgagactgagctcgtggacattgagaag
gctattgcacattatgaacaatctgctgattattacaaaggagaagaatctaacagctct
gctaacaagtgtctgctgaaggtggcagcctatgctgcacagctggagcagtaccagaaa
gccatcgagatctatgagcaggtgggagcaaacactatggataaccccttgctgaagtac
agcgcaaaggattacttcttcaaggcagcactctgtcacttcatagtggatgagctgaat
gcaaagcttgctcttgagaaatacgaggaaatgtttccagcatttactgactccagagaa
tgtaaattattgaaaaaacttctagaagctcatgaagaacagaacagtgaagcttacact
gaagcagtgaaggagtttgactcaatatcacgtttggatcagtggctgactaccatgttg
cttcgtatcaagaagtccattcaaggggatggagaaggagatggagacctcaagtga

DBGET integrated database retrieval system