KEGG   Rattus norvegicus (rat): 499906
Entry
499906            CDS       T01003                                 

Gene name
RGD1559924
Definition
(RefSeq) eukaryotic translation initiation factor 1-like
  KO
K03113  translation initiation factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    499906 (RGD1559924)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    499906 (RGD1559924)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-1
    499906 (RGD1559924)
SSDB
Motif
Pfam: SUI1 DUF2729
Other DBs
NCBI-GeneID: 499906
NCBI-ProteinID: XP_017447854
RGD: 1559924
Position
3
AA seq 106 aa
MSAIQNLHSFDPFDDASVGDDLLSAGTEDDFHIRIQQRNKKTLTLAQAITDDYNKKKLVK
AFKKKFACNGTVIEHAEYGEIIQLQDDQCKNICQFLVEIGLLREIS
NT seq 321 nt   +upstreamnt  +downstreamnt
atgtctgctatccagaacctccactctttcgacccgtttgatgatgcaagtgtgggtgat
gacctgctttctgctggcactgaggatgatttccacataagaattcaacagagaaacaag
aaaacccttacacttgcccaagcaatcactgatgattacaataaaaagaaactagtaaag
gcgtttaagaagaaatttgcttgcaatggtactgtaattgaacatgcagaatatggagaa
ataattcagctacaagatgaccagtgtaagaatatatgccagttcctggtagaaattgga
ctgctaagggagatcagctga

DBGET integrated database retrieval system