KEGG   Rattus norvegicus (rat): 499933
Entry
499933            CDS       T01003                                 

Gene name
Dsn1
Definition
(RefSeq) DSN1 homolog, MIS12 kinetochore complex component
  KO
K11544  kinetochore-associated protein DSN1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    499933 (Dsn1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     MIS12 complex
      499933 (Dsn1)
SSDB
Motif
Pfam: MIS13 DUF4909
Other DBs
NCBI-GeneID: 499933
NCBI-ProteinID: NP_001020939
RGD: 1565179
Ensembl: ENSRNOG00000006236
UniProt: Q4V7C0
Position
3q42
AA seq 348 aa
MTSVTKSEDQGPTMSETQDRPLQPSLEPLEALPRSSAYQEMMAQGTSEEQNHLGRSPREG
EGCGADPQEGPQLRSFHLSPQEQSARHRDRRQSWRRASMKEINRRKSLAPFHPGITELSR
SISMKLAQSQRLGALLLSSFQFSVEKLEPFLKNTKDFSLECFRAKASSLSEELKHFTDRL
GNDGTLQKCFVEDSKEKAPDFSLEASVAEVKEYITKFSLERQAWDRLLLQYQNEVPPEEM
PRGSTETKINEVNVDPAAYLRSSQKEVLNTKPDYQRIVQSQNEVFAYMELVMDELQGAVK
QLQAFMDESTQYLQKVSVQLKKRSMEQLDSSPARKLLKLHLQSSSTTQ
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgacttcggtgaccaaatcagaagaccagggaccaacgatgtcggagactcaggatcgt
ccattgcaaccaagtctcgagcctttggaagcattgcctcgatcctctgcctaccaggaa
atgatggcacaaggcacttcagaggaacaaaaccaccttggccggagccccagagagggg
gaaggttgtggtgctgacccccaggagggacctcagttgaggtcctttcatttgtctcct
caagaacagtctgcccgtcacagagacagaaggcagtcctggaggcgagcaagcatgaaa
gagataaaccggcggaagtcgttggctccttttcacccgggcatcacagagctcagcagg
tcaatcagtatgaagttagcacagagccaacggcttggcgccctcctgctctccagcttc
cagttctctgttgaaaaacttgaacctttcttaaagaacactaaggacttcagccttgaa
tgttttagagccaaagcatcttctctctctgaagaattgaaacattttacagacaggctg
ggaaatgatggaactctacaaaaatgttttgttgaagattcaaaagaaaaagcaccagat
ttctcactggaagcatcagtagctgaggtgaaagaatatataacaaagttttctttagag
cgtcaggcctgggatcggctcttactgcagtaccagaacgaggttccacctgaagagatg
cccagaggatcaactgaaaccaaaatcaatgaagtgaatgtggacccggcagcctacctc
aggtcttcccagaaggaagttctgaacacgaaacccgactatcagagaatagtgcagagt
cagaatgaagtctttgcctatatggaattagtgatggatgagctacaaggagcagtgaag
cagctgcaagccttcatggatgaaagtactcagtacctccagaaggtgtcagtacagctc
aagaagagaagtatggagcagttagattcttcacctgctcgaaaactgctcaagctccat
ctacagagctcatctaccacccagtga

DBGET integrated database retrieval system