KEGG   Rattus norvegicus (rat): 499952Help
Entry
499952            CDS       T01003                                 

Gene name
Bhlhe23, Bhlhb4, RGD1559760
Definition
(RefSeq) basic helix-loop-helix family, member e23
  KO
K09086  class B basic helix-loop-helix protein 4/5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    499952 (Bhlhe23)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Pancreatic factors
    499952 (Bhlhe23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH RecC_C Dynactin_p22
Motif
Other DBs
NCBI-GeneID: 499952
NCBI-ProteinID: NP_001102681
RGD: 1559760
Ensembl: ENSRNOG00000010312
UniProt: D3ZU26
Position
3q43
AA seq 223 aa AA seqDB search
MAELKSLSGDSYLALSHGYAATSHAYAAARGPETTRGFGASGPGGDLPAAPASRVPAATV
ESSGEQSGDEDEAFERRRRRRGPGVAVDARRRPREQRSLRLSINARERRRMHDLNDALDG
LRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQSLAAPVAAAP
LTPFGQAAVYPFTAGAALGPCPDKCATFSGSPSALCKHCGEKP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctcaagtcgctgtcgggggactcctacctggcgctcagccacggctacgcg
gcgaccagccacgcctacgctgcggcgcgcggaccggagacgacacgcggcttcggtgca
tcgggtcctggtggcgacctccccgcggcgcccgcttcccgcgtccccgccgcgactgtc
gagagcagcggcgagcagagcggcgacgaggacgaagccttcgagaggcggcggcggcgg
cgagggcccggggtcgcggtggacgcacggcggcggccccgggagcaacgctcgctgagg
ctcagcatcaacgcgcgcgagcggagacgcatgcacgacctgaacgacgcgctggacggg
ctgcgcgcagtcatcccctacgcgcacagcccgtcggtgcgcaagctctccaaaatcgcc
acgcttctgctagccaagaactacatcctcatgcaggcgcaggccttggaggagatgcgg
cgcttggtggcctatctcaaccaaggccagagcctcgcggcaccggtggccgccgcgcct
ctgacgcccttcggtcaggcagcggtttacccgttcacggccggcgccgcactcgggccc
tgcccggacaagtgtgccaccttctcgggatctccctcggcgctttgcaaacactgtggc
gagaagccctga

DBGET integrated database retrieval system