KEGG   Rattus norvegicus (rat): 499964
Entry
499964            CDS       T01003                                 

Gene name
En2, RGD1561842
Definition
(RefSeq) engrailed homeobox 2
  KO
K09319  homeobox protein engrailed
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    499964 (En2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, En
    499964 (En2)
SSDB
Motif
Pfam: Homeodomain Engrail_1_C_sig Homeobox_KN DUF2316 CENP-B_N
Other DBs
NCBI-GeneID: 499964
NCBI-ProteinID: NP_001102684
RGD: 1561842
Ensembl: ENSRNOG00000006846
UniProt: D3Z8B1
Position
4q11
AA seq 323 aa
MEEKDSKSSETAAEAQRQPEPSPGGGSGGGSSPSDSDTGRRRALMLPAVLQAPGNHQHPH
RITNFFIDNILRPEFGRRKDAGTCCAGAGGARGGEGGAGSTEGGGGADGAEQILGARESR
PNPACAPSAGGPLSGASGDPAADGEGGSKTLSLHGGAKKPGDPGGSLDGALKARGLGGGD
LSVSSDSDSSQASATLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTA
FTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKKATGNKNTLA
VHLMAQGLYNHSTTAKEGKSDSE
NT seq 972 nt   +upstreamnt  +downstreamnt
atggaggagaaggattccaagtccagcgagacggcggcggaggcgcagcggcagccggaa
cccagccccggcggcggctccggaggcggcagcagcccgagcgactcggacaccggccgc
cggcgtgctctgatgttgcccgcggtcctgcaggcgccaggcaaccaccagcatccgcat
cgcatcaccaacttcttcatcgataacatcctacgaccggagttcggccgccgaaaggat
gcggggacttgctgtgccggcgcgggcggagccaggggaggcgaaggcggcgctggcagt
acggagggaggcggcggcgcagacggagccgagcagatcctgggcgccagggagtcccga
ccgaaccctgcgtgcgcacccagtgcaggagggccgctctccggtgcctccggcgaccct
gcggccgatggagaaggcggctccaagacgctgtcgctgcacggtggtgctaaaaaaccc
ggagacccggggggttccttggatggagcgctcaaggcccggggcttgggcggaggtgac
ctgtcggtgagctccgactcggacagctctcaagccagcgccaccctgggcgcgcagccc
atgctctggccggcttgggtctactgcacacgttactctgaccggccttcttcaggcccc
aggtctcgaaaaccaaagaagaagaacccgaacaaagaggacaagaggccgcgcaccgcc
ttcactgctgagcagctgcagaggctcaaagctgagtttcagaccaacaggtacctgacg
gagcagaggcgccaaagtcttgcgcaggagctcagcctcaacgagtcccagatcaagatc
tggttccagaacaagcgggccaaaatcaagaaagccacgggcaacaagaacactttggcg
gtgcacctcatggcgcagggcctgtacaaccattccaccaccgccaaggagggcaagtcg
gacagcgagtag

DBGET integrated database retrieval system