KEGG   Rattus norvegicus (rat): 499971Help
Entry
499971            CDS       T01003                                 

Gene name
Iqca1l, Iqca1p1
Definition
(RefSeq) IQ motif containing with AAA domain 1 like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IQ DUF3530 baeRF_family11 AAA_5 AAA_16
Motif
Other DBs
NCBI-GeneID: 499971
NCBI-ProteinID: NP_001019488
RGD: 1564789
Ensembl: ENSRNOG00000011092
Vega: OTTRNOG00000001197
UniProt: A0A0A6YYL9
Position
4q11
AA seq 822 aa AA seqDB search
MSEGTYQRLWEASHATLEEVLEKEPSPLEPVLTRERQSFQYRISVLYLYYLGLLRRFNLA
YDQMVQPQKRRLLRRLLDGVAGRVLELKDELVRVDLCETHCLDRVLQELKLTPADLEVPI
PKYFQLEQTSTMKARQQMLAEILARLEPLASQENLRGMSRTEALIIVQCAERARQGRLRA
TFMREIRKEEERDRRIRENGRQKFSQDQGAIVIQKVWKGYLQRKRIEQDRRMEMEFIGML
PSSSQTTRQNALAQAFVGEESRRTRQVEKEEEFQEAIAKTHESLTETEGPDMKERMKDQI
RQWFIECHALTGRFPDYPDEASGGSYLIFADKTPEQVRQELEAQAQENKKKEQEKNKDKV
KEKKEKKKKKTKEEKAKKDPEVMFKVLPSKSIPVINAGHEEFTSIWKSRYDNKHPSQSFD
SETLREEKRKQVEMEIRVQVDELMRQELRNLRLAVDREETRPLKSPKKKGGKKSGKKKKE
KDLTPDRSVDSLFEELVVIGLIKKSLLVTLNDYIGDCLYLGSTLTLANKIPMPSLFDIRQ
NIALYGVLRLGSHDIHTMAPLVRSILLVGPSGMGKKMLVQAVCTETGANLFDLSPGNVMG
KYPGKNGSQLLMHIVFKVARVFQPSVIWIGNTEKTFYKKIPKEERRMDPKRIKKDLMRAT
RQLGPGDRVMLIGTTERPQLAEMKGLCRFYERILFIPRPDYASRYVLWKRMIENQGIGVQ
QTQSLDISALARVSDGYTPGHILQSIQSVLTERRLLQLTKKPLVASEFVVHLAKLDPVYR
EEEESLKEWFYKTPLGKKNIKFTKDQQEAEEARLAKEKKKKK
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagggaacttaccaacgcctctgggaggcctcccacgcgactctggaagaggtg
ctggaaaaagagccatctccgcttgaacccgtgctcacccgggagcggcagagcttccag
tacaggatctcggtgctttacctgtactacctggggctgctgcgccgcttcaacctggcc
tacgaccagatggtgcagccacagaagcgtaggttgctgcggcgccttctggacggtgtg
gcaggacgcgtgctggagcttaaggacgagctggtgcgcgtcgacttgtgtgagacccac
tgcctggaccgagtgttgcaggaactcaagctaaccccggcagacttggaggttcccatc
cccaagtattttcagctggagcagaccagcaccatgaaggcccgtcagcagatgctggcc
gagatcctggccagactggagccactggcttctcaagagaatcttcgaggaatgagccgg
actgaggccctgattatagtgcaatgtgccgagagggctaggcagggccgactacgagcc
accttcatgcgagagattaggaaagaggaggaacgggaccggaggattcgagagaatggg
cgacagaaattcagtcaggaccagggagccattgtcatacagaaggtgtggaaaggttac
ctacagagaaaacgtattgagcaagatcgacgcatggagatggagttcattggcatgctc
ccctcgtccagccagacaacgagacagaatgcccttgcccaggccttcgtgggggaggag
tcacggaggacccggcaggtggaaaaggaagaggaattccaggaagccatagcgaaaacc
cacgagtctctcacggagaccgagggccctgacatgaaggagaggatgaaggaccagata
cgacagtggtttattgaatgccatgcccttactggtcggttccctgattatccagacgag
gcttcaggtggatcctacctgatcttcgcagacaagactccagagcaggtgagacaagaa
ctggaagcacaggcccaggagaataaaaagaaggaacaagagaagaataaggacaaagtg
aaggaaaaaaaggaaaagaagaaaaagaaaaccaaggaagaaaaggccaagaaggaccca
gaagtgatgttcaaagtgctgccatccaaatctatccctgtgattaacgctggtcacgag
gaattcacaagtatttggaagagccgctatgacaacaaacaccccagccagagctttgac
tctgagaccctccgggaggagaaaaggaagcaagtggagatggagatccgggtgcaggtg
gatgagctaatgagacaggaactgaggaatttgcgtctggctgtggacagggaagagacc
agacccctcaagtctccaaagaaaaaaggcgggaaaaagagtggaaagaagaagaaggaa
aaggatctgaccccagacaggtctgtggactcattgtttgaagagcttgttgtcatcggc
cttataaagaagtctctgcttgtgacactgaatgactacattggtgactgcctctatctc
gggtccactctgaccttggcaaacaagatacccatgccttccctgtttgatatacggcag
aacatagcactgtatggtgttcttcggttgggctcccatgacatacataccatggcaccc
cttgtccgctccatcctcctggtgggaccctctggcatggggaagaagatgttggtccaa
gcggtgtgcacagaaactggtgccaacctgtttgacctgtcacctggcaacgtgatgggc
aaatacccagggaagaatggatcacagctattgatgcacatcgtctttaaggtggcccgg
gtcttccagccctctgtcatttggattggaaatactgagaaaaccttctacaagaagatc
ccaaaggaagaaaggaggatggacccaaagagaataaagaaagacctcatgagggccacg
agacagctgggccctggtgaccgagtgatgctgataggaaccacggagcgcccacagctg
gccgagatgaaggggttgtgccggttctatgagcgcatcctcttcataccccggcctgat
tacgcttctcgttatgtgctctggaaacggatgatagagaaccagggaataggggtacag
cagacccagagtctggacattagtgccctggctagggtgtctgatggctacacacctggt
cacattctacaatccatccagtcagtgctgacagaacgccggctccttcaactgaccaag
aagccactggttgcctccgagtttgtggtgcacttggcaaagctggatccagtatacagg
gaggaggaggaatccctaaaggaatggttttataagactccgctgggaaaaaagaatata
aaatttaccaaggaccaacaggaggctgaggaggccagactggcgaaggagaagaagaag
aaaaagtga

DBGET integrated database retrieval system