KEGG   Rattus norvegicus (rat): 499975
Entry
499975            CDS       T01003                                 

Gene name
Fam126a, Drctnnb1a, RGD1562906
Definition
(RefSeq) family with sequence similarity 126, member A
  KO
K21844  protein FAM126
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    499975 (Fam126a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    499975 (Fam126a)
SSDB
Motif
Pfam: Hyccin
Other DBs
NCBI-GeneID: 499975
NCBI-ProteinID: NP_001178898
RGD: 1562906
Ensembl: ENSRNOG00000010517
UniProt: D4AE31
Position
4q11
AA seq 521 aa
MFTSEIGVVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQSELLEPVCHQL
FEFYRSGEEQLLRFTLQFLPELIWCYLAVSASRNVHSSGCIEALLLGVYNLEIVDKHGHS
KVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEV
LTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYGGASSRIPISSGFMVQM
LTGVYFAIYNGEWDLAQKALDDIIYRAQLELYPEPLLVANAIKASLPPGAMKSSKEGTRC
IQVEITPTSSRISRNAVTSMSIRGHRWKRHGDTELTGQEELTEITEVDEGFYSRAASSTS
QSGLSISSHNCSHKTSVGKNQRRSGGSKAGAKERETAGESCRDHFARKQTQRAQSENLEL
LSLKRLTLTSSQSLPKPSSHGLAQTAATVFSKSFEQVSGVPGPRSPSPAIGCVAGADAHR
FSACSLQEEKLIYGSERIDLPLKCQAGQRGPPSVSITLSAD
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgttcacctcagagataggggttgtagaagaatggctgtcagaatttaagacactccca
gaaacatctttgccaaattatgccacaaatttgaaagacaagagttctttagtttcatct
ctctataaagttatccaggagccacagagtgagttactagagcctgtgtgtcaccagctc
tttgagttctaccgcagtggggaggaacagctgctgcggttcactctgcagtttctcccc
gagctgatctggtgctaccttgccgtgtcagccagcagaaatgtgcacagcagcggctgc
attgaggcccttcttctgggggtttacaacctggaaatagttgacaaacatggacatagt
aaagtactgagttttacaattccgtctttatccaaaccatctgtataccatgaaccttcc
agcattgggtctatggcactgaccgagagtgcactctcccagcatggcttatcaaaagtc
gtgtacagtggcccccatcctcaacgggagatgctgacagcacagaacaggtttgaagtg
ctgacattccttctgctgtgttacaacgctgccttaacctacatgcccagtgtttctctc
cagtcactgtgtcagatctgttcaagaatctgtgtgtgtggatatccccgacaacacgta
agaaagtacggaggtgcaagcagcaggataccgatctcatctggcttcatggtacagatg
ctaacaggcgtgtattttgccatatacaatggagaatgggatctagctcagaaagcactg
gatgacattatatacagagcccagctagaactatacccagagccactgctggttgctaat
gcaataaaggcttcattgcctccgggtgccatgaaatctagtaaggaaggtacacggtgt
attcaagtggagatcacaccaacgtcctccagaatatcaaggaatgcagttaccagcatg
tcaataagaggtcacaggtggaaaagacatggagatacagagttaacaggtcaagaagaa
ctgacggagataactgaagttgacgagggattttattccagggctgcgtctagcaccagc
cagtcgggtctatcaatcagtagtcacaattgtagtcacaagacaagtgtaggaaagaac
cagagacggtcgggaggaagcaaagctggagcaaaggagagagaaactgcaggggaatct
tgcagagatcactttgctcgcaaacaaacccagagagcccagagcgagaaccttgagctt
ctctctctgaagagactgaccttgacctccagccagtccctgcccaagcccagcagccac
ggcttggctcagactgcggccactgtatttagtaaatcctttgaacaagtgagtggggtc
ccaggcccacgtagcccttctcctgccattggctgtgttgctggggcagatgcccataga
ttttctgcttgtagtctccaagaagagaagcttatttacgggtcagaaaggattgacctt
ccactgaagtgtcaagcaggccagcgggggcctcctagtgttagcatcactctgtctgca
gattaa

DBGET integrated database retrieval system