KEGG   Rattus norvegicus (rat): 499979
Entry
499979            CDS       T01003                                 

Gene name
Fam185a, RGD1562135
Definition
(RefSeq) family with sequence similarity 185, member A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF4097 DUF2807
Other DBs
NCBI-GeneID: 499979
NCBI-ProteinID: NP_001121660
RGD: 1562135
UniProt: B1WBS7
Position
4q11
AA seq 208 aa
MFGRLPPCASRVRAGALFGALGTRTCGSGGAERRGSVPANPGAGLARGDLREWTLRVSPF
GRLRARLPCHLSVRPLDPLAHPDGDRVLVAVSGVGSGTRGLDSLQVKYDAALQEMAILSD
DIDPEASVEVNAPVKFDLNIESSGAGSVSVQNIECDSCKIDTEQGTSILQSVKSQKLHVN
TKGGDVVCLGTIYGNIDIHASDKSEISC
NT seq 627 nt   +upstreamnt  +downstreamnt
atgttcggccgcctccctccttgcgcgtcccgggtgcgggcgggcgccttgttcggagct
ctggggacccggacatgcggctccggtggggccgagcggcggggctcggtgcccgcgaac
cctggggccggcctggcacgcggggatctgagggagtggacgctgagggtgagcccgttt
gggcggctgagggcgcggctcccatgccacctgtccgtgaggcccctggatcccctcgcg
cacccggacggcgaccgcgtgctagtggcggtgagcggcgtggggagcgggacgcgtggc
ctagacagcctgcaggtcaagtatgacgctgctctgcaggagatggccattctgtcagac
gacattgatcccgaggcgtcggtggaggtgaacgcacccgtcaaatttgatttaaatatc
gagtcatcaggggctggctctgtgagcgtgcagaatattgagtgcgatagctgtaaaatt
gacactgagcaggggaccagcatcttgcagtctgtgaagagtcaaaagttacatgtgaac
acaaaaggaggtgatgtggtctgtcttggaacaatttacggaaatatagacatccacgcg
tcagataaaagtgaaatatcgtgttag

DBGET integrated database retrieval system