KEGG   Rattus norvegicus (rat): 499985
Entry
499985            CDS       T01003                                 

Gene name
RGD1565355
Definition
(RefSeq) similar to fatty acid translocase/CD36
  KO
K06259  CD36 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04145  Phagosome
rno04152  AMPK signaling pathway
rno04512  ECM-receptor interaction
rno04640  Hematopoietic cell lineage
rno04920  Adipocytokine signaling pathway
rno04931  Insulin resistance
rno04975  Fat digestion and absorption
rno04979  Cholesterol metabolism
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    499985 (RGD1565355)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    499985 (RGD1565355)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    499985 (RGD1565355)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    499985 (RGD1565355)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    499985 (RGD1565355)
   03320 PPAR signaling pathway
    499985 (RGD1565355)
  09154 Digestive system
   04975 Fat digestion and absorption
    499985 (RGD1565355)
   04979 Cholesterol metabolism
    499985 (RGD1565355)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    499985 (RGD1565355)
  09174 Infectious disease: parasitic
   05144 Malaria
    499985 (RGD1565355)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    499985 (RGD1565355)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    499985 (RGD1565355)
   04090 CD molecules [BR:rno04090]
    499985 (RGD1565355)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    499985 (RGD1565355)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   499985 (RGD1565355)
CD molecules [BR:rno04090]
 Proteins
  499985 (RGD1565355)
SSDB
Motif
Pfam: CD36 PorA
Other DBs
NCBI-GeneID: 499985
NCBI-ProteinID: NP_001102688
RGD: 1565355
Ensembl: ENSRNOG00000043176
UniProt: Q5BKE5
Position
4q11
AA seq 472 aa
MGCDLNCGLITGAIIGAVLAVFGGILMPVGDLLIEKTIKREVVLEEGTIAFKNWVKTGTT
VYRQFWIFDVQNPEEVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPKDSTVSFVQPNGA
IFEPSLSVGTENDNFTVPNLAVAAAPHIYQNSFIQGVLNNLIKKSKSSMFQTRSLKELLW
GYKDPFLSLIPYPISTTVGVFYPYNNTVDGVYKVFNGKDNINKVAIIDTYKGKRNLSYWK
SYCDMINGTDAASFPPFVEKSRTLRFFSPDICRSIYAVFESEVNLKGIPVYRFVLPVNAF
ASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIQGL
NPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALRNLKRPYIVPILWLNETG
TIGDEKVEIFRNQVTGKINLLDLVERVLLVVGVLMFVAFMISYCACRSKNGK
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgggctgtgatctgaactgtgggctcattactggagccattattggtgctgtcctggct
gtgtttggaggcattctcatgccggttggagacctgctcattgagaagacaatcaaaagg
gaagttgtccttgaagaaggaaccattgctttcaaaaactgggtgaaaacgggcaccact
gtgtacagacagttttggatctttgacgtgcaaaacccagaggaagtggcaaagaatagc
agcaagatcaaggttaaacagagaggtccttacacatacagagttcgttatttagccaag
gaaaatataactcaggaccccaaggacagcactgtctcttttgtacaacccaatggagcc
atctttgagccttcactgtctgttggaacagagaatgacaacttcacagttcccaatctg
gctgtggcagctgcaccacatatctaccaaaactcatttattcaaggtgtgctcaacaac
cttatcaaaaagtccaagtcttctatgttccaaacacgaagtttgaaggaactcctgtgg
ggttacaaagatccattcttgagtttgattccatatcctataagtaccacagttggtgtg
ttttatccttacaataacactgtagatggagtttataaagttttcaatggaaaggataac
ataaacaaagttgccataattgatacctataaagggaaaaggaatttgtcctattggaaa
agttattgcgacatgattaatggcacagatgcagcctcctttccaccttttgttgagaag
tctcgaacactgaggtttttttcccctgacatttgcaggtccatctatgctgtgtttgaa
tctgaagtgaaccttaaaggaatccccgtgtacagatttgttcttccagttaacgccttt
gcctccccactccagaacccagacaaccactgtttctgcactgaaaaagtaatctcaaat
aactgtacgtcttatggtgtgctggacattggcaagtgcaaagaaggaaagcctgtgtac
atttctcttccacatttcctacatgcaagtcctgatgtctcagaacctatccaaggtttg
aatcctaacgaagatgaacataggacatacttggatgtggaacccataactggattcact
ctacagtttgcaaaacgactgcaggtcaacatactggtcaagccagctagaaaaatagaa
gcactgaggaatctgaagagaccttacattgtacctatactgtggctaaatgagactggg
accattggcgatgagaaagtggaaatattcagaaaccaagtgactgggaaaataaacctc
ctggacctggtagagagggtcttacttgttgttggagtactgatgtttgtggcttttatg
atttcatactgtgcttgcagatctaagaatggaaaataa

DBGET integrated database retrieval system