KEGG   Rattus norvegicus (rat): 499993
Entry
499993            CDS       T01003                                 

Gene name
RGD1564345
Definition
(RefSeq) similar to RIKEN cDNA 4921511H03
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Glyco_H_20C_C
Other DBs
NCBI-GeneID: 499993
NCBI-ProteinID: NP_001071149
RGD: 1564345
Ensembl: ENSRNOG00000008594
UniProt: A0JPP5
Position
4q12
AA seq 253 aa
MSFIVHNRRSSKKQFQVDPLLMPKVPRINYLHIQEEKHRLQLKKFLLHRLFLVGYIQANT
EKKEISEYYEQLFQSILKHHLGEVVTGLFLIYPSSFLHILESSNGTLFRILLDYVAHEKS
EREFMIQNMKIIVASHNIPTRLFMQWHISIIKVPVLYLDDDTQSQSVEEVTTDFLTLTHK
LALHLYKTVKLGGKGPGDNLHQLAPELILPEKTIKYLCKATEFMDPASFLSMYNRPIHIT
MDSDIVWPAPSRF
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtctttcatcgtccataatcggaggagcagcaaaaagcaatttcaagtggatcctcta
cttatgcccaaggttcctcgtatcaattacttgcacatccaggaagagaagcacaggcta
cagctgaagaaattcctccttcacaggttgtttctagtgggctacatacaagccaacaca
gagaaaaaggaaatttctgaatactatgagcaactgtttcagtcaattctgaaacaccat
ttaggtgaagtagtgacaggactcttccttatatacccaagttcgtttctgcacatcctg
gagagctccaatggcacactgttccggattcttctagattacgttgcccatgaaaagagc
gaaagagaatttatgatccaaaacatgaaaatcatcgttgcttctcataacatccccacg
aggctgttcatgcagtggcacatctctatcatcaaagtcccggttttgtacctagatgac
gacacgcagtcgcagtccgtagaggaagtcaccacagatttcctcaccttgactcacaaa
ctggcactccatctttacaagacggtaaaactgggtggtaaagggccaggtgacaaccta
caccaacttgccccagaactcattctcccagaaaaaactatcaagtacttatgcaaagcc
acagaattcatggacccagcatcattcttaagcatgtataacagacccatacacattacc
atggattctgatattgtgtggccggctccttcccgtttctag

DBGET integrated database retrieval system