KEGG   Rattus norvegicus (rat): 500000Help
Entry
500000            CDS       T01003                                 

Gene name
Cldn12, RGD1561053
Definition
(RefSeq) claudin 12
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4321
Motif
Other DBs
NCBI-GeneID: 500000
NCBI-ProteinID: NP_001094283
RGD: 1561053
Ensembl: ENSRNOG00000039862
UniProt: D4A8Y0
Position
4q13
AA seq 244 aa AA seqDB search
MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTIYTGLWVKCAR
YDGSSDCLMYDRTWYLSVDQLDLRVLQFALPLSILIAMGALLLCLIGMCNTAFKSSVPNI
KLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWAIFYNSHLNKKFEPVFTFDYAVFVTIA
SSGGLFMTALLLFVWYCACKSLSSPFWQPLYSHPPGMHTYSQPYSSRSRLSAIEIDIPVV
SHST
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggctgccgagatgtccatgcagccacggtcctctccttcctgtgcggcattgcctct
gtagcaggcctcttcgcggggactctgcttcccaactggaggaagctgcgactcatcaca
ttcaacagaaatgagaagaacctgacgatctacacgggcctgtgggtgaagtgcgcccgg
tatgacggaagcagtgactgcctgatgtacgaccgcacttggtacctgtcggtcgaccag
ctggacctgcgcgtcctccagttcgccctgcccctcagcatcctgatcgcaatgggtgcc
ttgctgctctgcctgattgggatgtgcaacacggccttcaagtcttcggtgcctaacatc
aaactggccaagtgtctggtcaatagtgcaggctgccacctggtggctggactcctgttt
ttcctggcaggtaccgtgagcctctctccatccatctgggccatcttctataacagccat
ctcaacaagaagttcgagccggtctttacctttgactatgcagtgtttgtcacgatcgct
agctcagggggtctgttcatgactgctcttctgctgtttgtttggtactgtgcatgcaag
tctttgtcctctcctttctggcagccactgtactcccatcctcctgggatgcacacttac
tcacagccctattcatcacggtcccgcctctctgccattgaaattgacattccggtagtt
tcacatagcacttaa

DBGET integrated database retrieval system