KEGG   Rattus norvegicus (rat): 500005
Entry
500005            CDS       T01003                                 

Gene name
Gatad1
Definition
(RefSeq) GATA zinc finger domain containing 1
  KO
K23407  GATA zinc finger domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    500005 (Gatad1)
   03036 Chromosome and associated proteins [BR:rno03036]
    500005 (Gatad1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    500005 (Gatad1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    500005 (Gatad1)
SSDB
Motif
Pfam: GATA
Other DBs
NCBI-GeneID: 500005
NCBI-ProteinID: XP_001068512
RGD: 1562004
Ensembl: ENSRNOG00000008613
UniProt: D4A3T2
Position
4q13
AA seq 264 aa
MPLGLKPTCSMCKTTSSSMWKKSPQGEILCHHCTGRGGGGGGAGVAGGTGGGGGFGTATF
ATTSAGPSQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKN
PIKAPESVSTIVTAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAAL
TWLIPTLASPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPE
KGYIWTHVGPTPAITMKETVANHL
NT seq 795 nt   +upstreamnt  +downstreamnt
atgccgctgggcctgaagcccacctgcagcatgtgcaagaccacgtcgtcctccatgtgg
aagaagagtccacagggcgagatcctctgtcatcactgcaccggccggggcggcgggggc
ggcggcgcgggagtggcgggcgggaccgggggcggaggcggcttcggcactgctaccttc
gccaccacctcggccggtccgtcgcagagcaacgggggcgggggcggcaagcagagtaag
caagaaattcacagaaggtctgctcggctcagaaataccaagtacaaatctgctccagct
gctgaaaagaaagtttccactaaaggaaaagggagaagacatatttttaagttaaaaaac
cctatcaaagctcctgagtctgtttctaccatagtcactgcagagtcaatcttctacaag
ggagtatattaccaaattggtgatgttgtttctgtgattgatgagcaagatgggaagccg
tactatgctcagatcaggggtttcattcaggaccagtattgtgagaagagtgccgcactg
acatggctcattcccaccctcgctagtcccagagaccagtttgatcctgcatcatatata
atagggccagaggaagaccttccaaggaagatggagtacctggaatttgtctgccacgcc
ccttctgagtatttcaagtcaaggtcatcaccatttcccacagttcccacccgaccagag
aagggctacatatggactcatgtcggacctactcctgcaataactatgaaggaaacagtt
gccaaccacttgtag

DBGET integrated database retrieval system