KEGG   Rattus norvegicus (rat): 500007Help
Entry
500007            CDS       T01003                                 

Definition
(RefSeq) similar to EF hand calcium binding domain 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 500007
NCBI-ProteinID: XP_006224883
RGD: 1588445
Ensembl: ENSRNOG00000009135
UniProt: F1LX06
Position
4q13
AA seq 217 aa AA seqDB search
MEQRALKKLVESFRKTVKCFKKFEVECLIQLFYSLAGCPIGKVDNTKLDCNAFRGVLQNF
FGMTNDVLMNRVFFVFDKDGDSHVNLQEWIKGLAVFLRGTFEEKMRFCFEVYYLSGDAYI
SREKIFDMLKSSLFHNSPEEENEEGIKDLVEISLKKMDYDNDGKISFEDFEKAVRKDGLL
LEAFGPCLPDAKTCFHFEALVFKNNSPASFEHNPLNT
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggagcagagggctctgaagaaactggtggagtccttcagaaaaactgtcaagtgcttc
aagaagtttgaagttgaatgtctcatacagcttttctatagcttggcgggatgccctatt
gggaaggttgataacaccaagctggactgcaacgcattccgaggggttctacagaacttt
tttggaatgactaatgatgtgctgatgaatagggttttctttgtatttgacaaagacggt
gatagccatgtaaatttgcaagagtggattaaaggcttggctgtgtttctccgcgggact
tttgaagagaagatgagattctgttttgaagtttattatttaagtggagatgcttatatt
tcccgggaaaaaatttttgacatgttgaagagtagtctcttccacaactctcctgaagaa
gagaacgaagaaggaataaaggatttggtagaaataagcctgaagaagatggattatgac
aatgatggcaagatctcttttgaagactttgaaaaggcagtgagaaaagacggtcttttg
ttggaggcgtttggaccatgtttaccagatgcaaagacctgctttcatttcgaagctctg
gtattcaaaaacaactcccctgctagttttgagcacaacccgctcaacacttga

DBGET integrated database retrieval system