KEGG   Rattus norvegicus (rat): 500037Help
Entry
500037            CDS       T01003                                 

Gene name
Foxp2, RGD1559697
Definition
(RefSeq) forkhead box P2
  KO
K09409  forkhead box protein P2/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    500037 (Foxp2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    500037 (Foxp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXP-CC Forkhead Plasmodium_Vir
Motif
Other DBs
NCBI-GeneID: 500037
NCBI-ProteinID: NP_001258033
RGD: 1559697
Ensembl: ENSRNOG00000054508
UniProt: P0CF24
Position
4q21
AA seq 710 aa AA seqDB search
MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQA
ARQLLLQQQTSGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
LLQQQQAVMLQQQQLQEFYKKQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQHPGKQAKEQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQCQGLISIP
PGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSQEDNGIKHGGLDLTTNNSSSTTSSTTS
KASPPITHHSIVNGQSSVLNARRDSSSHEETGASHTLYGHGVCKWPGCESICEDFGQFLK
HLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSPKPLNL
VSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSDKYNI
PMSSEIAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNA
ATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPTSLGYG
AALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQ
PHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggaatctgcgacagagacaataagcaacagttcaatgaatcaaaatggaatg
agcactctaagcagccaattagatgctggcagcagggatgggagatcaagtggtgacact
agctcagaagtaagcacagtggagctgctgcatctgcaacaacagcaggctctccaggca
gcgaggcaacttctgttacagcagcaaacaagtggattgaaatctcctaaaagcagtgat
aaacagaggccactgcaggtgcccgtgtcggtggccatgatgactccccaagtgatcacc
cctcagcagatgcagcagatccttcagcagcaggtcctgtctcctcagcagctccaggcc
ctcctccagcagcagcaggctgtgatgctgcagcagcaacaactacaagagttttacaag
aaacagcaagagcagttacatcttcagcttttgcagcagcagcaacagcagcagcagcaa
cagcagcagcagcaacagcagcagcagcagcagcaacagcagcagcagcagcagcaacag
cagcagcagcaacaacagcaacatcctggaaagcaagcaaaagagcagcagcagcaacag
cagcaacagcagttggccgctcaacagcttgtcttccagcaacagcttctccagatgcag
caactacagcagcagcagcatctgctcagccttcagtgtcagggcctcatctccatacca
cccggccaagcagcacttcccgtccagtcgctgcctcaagctggcttaagtcctgccgag
attcagcaactgtggaaagaagtgactggggtccacagtcaggaagacaacggcattaaa
catggagggctcgacctcacaaccaacaattcctcctcgactacctcctccaccacttcc
aaagcttcaccgccaataacacatcattccatagtgaatggacagtcttcagttctgaac
gccaggcgggacagttcgtcccacgaggagactggggcctcccacactctctatggccat
ggagtttgcaaatggccaggctgtgaaagcatctgtgaagatttcggacagtttttgaag
caccttaacaatgaacatgcattggatgaccgaagcactgcccagtgccgagtgcaaatg
caggtggtacagcaattagaaatacagctttctaaggaacgcgaacgtcttcaagcgatg
atgacccacttgcacatgcgaccctcagagcccaaaccatctcccaaacctctaaatctg
gtgtctagtgtcaccatgtcgaagaacatgttggagacatccccacagagcttacctcaa
acccctaccacaccaacggccccagtcaccccgattacccagggaccctcagtaatcacc
ccagccagtgtgcccaatgtgggagccatacgaaggcgacattcagacaaatacaacatc
cccatgtcatcagagattgccccaaactacgaattttataaaaacgcagatgttagacct
ccctttacttatgcaactctcataaggcaggctatcatggagtcatctgacaggcagtta
acacttaatgaaatttacagctggtttacacggacatttgcttacttcaggcggaatgcc
gcgacttggaagaatgcagtacgtcataatcttagcctgcacaaatgttttgttcgagta
gaaaatgttaaaggagcagtgtggactgtggacgaagtagaataccagaagcgaaggtca
caaaagataacaggaagtccaactttagtaaaaaacatccccacaagtttgggctatgga
gcagcccttaatgccagtctgcaggctgccttggcagagagcagtttgcctttgctaagt
aaccctggactgatcaataacgcctccagtggcctcctgcaggccgtccacgaagacctc
aatggttccctggaccacatcgacagcaatgggaacagcagtccgggctgctcacctcag
ccacacatacattcaatccatgtcaaagaagaacctgtgattgcagaggatgaagactgt
ccaatgtctttagtgacgacagccaatcacagtccggagctagaagatgacagagagatt
gaggaagagcctttatctgaggacctggaatga

DBGET integrated database retrieval system