KEGG   Rattus norvegicus (rat): 500048Help
Entry
500048            CDS       T01003                                 

Gene name
Fezf1, RGD1560480
Definition
(RefSeq) Fez family zinc finger 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf-Di19 zf-met zf-Sec23_Sec24 zf-AN1 zf-C2H2_12
Motif
Other DBs
NCBI-GeneID: 500048
NCBI-ProteinID: NP_001102694
RGD: 1560480
Ensembl: ENSRNOG00000007608
UniProt: D3ZPD6
Position
4q22
AA seq 475 aa AA seqDB search
MDSSCLNATTKMLATAPARGNVMSTSKPLAFSIERIMARTPEPKALPVPHFLQGAVPKGD
PKHSLHLNSSIPCMIPFVPVAYDTNSKAGVNGSEPRKASLEVPAPPAVAPSAPAFSCSDL
LNCALSLKGDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAAGVNIHP
VASYFLSSPLHPQPKTYLAERNKLVVPAVEKLPSGVAFKDLSQAQLHNYMKESAQLLSEK
IAFKTSDFSRGSPNAKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQA
STLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYK
NHKLTHSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVR
KLHDSSLGLTRTPTGEPGSDPPPQLQQPPPAPLPPLQPTLPPPGPLQSGLHQGHQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggacagtagctgcctcaacgcgaccaccaaaatgctagcgactgctccagctcggggc
aacgtgatgagcacatccaaacccttggctttctccatcgaacgaatcatggcgcgcacc
cctgagcctaaggccctgccggtcccccacttcctgcagggagccgtgcccaaaggggac
cccaagcactctctgcatctcaactcgtcgatcccctgcatgatccctttcgttcccgtg
gcgtacgacacgaactccaaagcaggagtgaatggctcagagccccgcaaagcgagtttg
gaggttccggcgccgcccgcggtggcgccctccgcgcccgcgttcagctgcagcgacctg
ctcaactgcgctctaagtctcaagggcgacctggcccgcgacgcgctgccactacagcag
tacaagctggtaaggccgcgtgtggtgaaccactcttcgttccacgccatgggcgccctg
tgctacctgaaccgaggtgacggcccgtgccacccggctgcgggcgtgaacatccacccc
gtggcctcctactttctcagttcccctttgcacccacagcccaaaacatatttagccgaa
aggaataaactggtcgtcccggcggtggagaagctaccttcgggagtagctttcaaagac
ctgtcccaggctcagctacacaattacatgaaagaaagcgcccaacttttgtcggaaaaa
atcgctttcaaaacctcggatttcagccgcggctctcctaacgccaaacccaaagttttc
acttgcgaagtctgcggaaaggtctttaatgcgcactataacttaacccgtcacatgccg
gtgcacacaggagccagacccttcgtgtgcaaagtgtgtgggaaaggtttccggcaagcc
agcaccctttgccggcataagatcattcacacacaggaaaaaccccacaaatgcaaccag
tgcgggaaagcgtttaatagaagttccacgttaaacacacacacccgaattcacgcgggc
tacaaaccattcgtgtgtgaattctgtggcaaaggatttcatcaaaaagggaattacaaa
aatcacaagctgacccacagcggggagaagcagttcaagtgcaatatctgcaacaaggct
ttccaccaggtgtacaacctcaccttccacatgcacactcacaacgacaagaagcctttc
acttgccccacgtgtggcaagggcttctgtaggaactttgacctcaagaagcatgtccgc
aagctacacgacagcagcctggggctgacccgcactcctactggggagccaggcagcgat
ccgccgccccagctgcaacagccgccgcccgcgcctctgccgccgctgcaacctaccttg
ccgcctcccgggcctctgcaatccgggcttcaccaaggccaccagtga

DBGET integrated database retrieval system