KEGG   Rattus norvegicus (rat): 500084
Entry
500084            CDS       T01003                                 

Gene name
Trim24
Definition
(RefSeq) tripartite motif-containing 24
  KO
K08881  tripartite motif-containing protein 24 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    500084 (Trim24)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    500084 (Trim24)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     500084 (Trim24)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  TIF1 family [OT]
   500084 (Trim24)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    500084 (Trim24)
SSDB
Other DBs
NCBI-GeneID: 500084
NCBI-ProteinID: NP_001037731
RGD: 1560596
Ensembl: ENSRNOG00000013251
UniProt: Q7TP39
Position
4q22
AA seq 866 aa
MAQRQQVQRRPAPVGSPNPRMQGPIQQPSISLQHPPPRLINFQNHSPKPNGPVLPPYPQQ
LRYPPSQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQATPTTASSSSSTPSSPTITSAA
GYDGKAFSSPMIDLSAPVGGSYNLPSLPDIDCSSTILLDNIARKDTSVDPGQPRPPSNRT
VQSPNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVML
EPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNTNYPRSILTSLLLNSSQSSASEETV
LRSDAPDSTGDQPALHHENSPNGKSEWPDASQKSPVHVGETRKEDDPNEDCGEWICTFCR
DLSKPEVEYDCDAPSHNSDKRKSEGLTKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLT
PDSEVANAGIKLESYFEELLKNLYPEKRFPKLEFRHDVEDCKFSDDSDDDFVQPRKKRLK
SMEDRQLLKTSTNIDLKSLGICETIPISSYLKEKERLRQPTAAHSQPRRHEVWRRKQSGV
RTIKRGGPADERLVIAIAEDNIHFGQGLGGTEMESTWKPPPRGLILTSNDSQQAAKREEQ
SLVLPSGKAQTHNHQQQGNIPSGATVALTSADADACVVIKDGVLNGYRFEFYKHVTFIYF
SCVRGCECIHGACGGQRITRRLRTVLLSRRSGELNSDYPVWQQASSPSICHSDKFEEHPD
FIRKGRDLVFERLDFSRLNKRGEIHIKLSGIISTGRFKKLVKWLSAVRDAQAESSPGTSH
ASAPLPNAHLSSVNVDGVEVRRHQGPQHEEEANEAGTEEEAEEVIGTDTEDLPGWPHKAL
SLGRLLFLNRPNCGILSQFPHNPFTK
NT seq 2601 nt   +upstreamnt  +downstreamnt
atggctcagaggcaacaggtgcaacggaggccggcacctgtgggttcaccaaaccctaga
atgcaggggcccatccagcagccttccatctctcttcagcatccaccaccacgcttaata
aactttcagaaccacagccctaagcccaatggaccagtgcttcctccttatcctcagcag
ctgaggtacccacccagccagaatataccacggcaggcaataaagcccaaccccctgcag
atggcttttttggctcaacaggccataaaacagtggcagatcagcagtggacaggctacg
cctacaactgccagcagctcctcctccactccttccagtcccacgatcacaagtgcagct
gggtacgatggaaaagctttcagttcacccatgattgatctgagtgcaccagtgggaggg
tcttacaatcttccttctcttccagatattgattgttcaagtactatcttgttggacaat
attgcaaggaaggatacaagtgtagaccctggccagccaagacctccatcaaacagaacc
gtgcagtcaccaaattcatcagtgccgtctccaggcctggcagggcctgttactatgact
agtgtccatcccccaatacgttcacctagtgcctccagtgttgggagccgaggaagctcg
ggctcttccagcaaaccagcaggagcggattctactcacaaggtcccagtagtcatgctg
gagccaattcgaataaaacaggaaaacagtggaccacctgaaaactatgattttcctgtt
gttatagtaaaacaagaatcagatgaagaatctagacctcaaaatactaactatccaagg
agcatactgacctccctcctcctaaacagtagccagagctctgcttctgaggagacggtg
ttacggtccgatgcccctgatagtacaggagatcagcctgcactccatcatgaaaactcc
ccaaatggaaagtctgagtggccggatgcctcccagaagtcccctgtgcatgttggagag
acaagaaaggaggatgaccccaatgaagactgtggagaatggatttgtactttctgccgg
gacttatctaagccagaagttgaatatgattgtgatgctcccagtcacaactcagataaa
aggaaaagtgaaggccttactaaactaacaccaatagacaaaaggaaatgtgagcgcctg
ctcctgttcctttactgccatgagatgagcctggctttccaggaccccgtccctctgact
cctgattctgaagtagccaatgccggtataaaacttgaaagctattttgaagaacttcta
aagaatctttatccagagaagaggttccctaagctagaattccggcatgacgtggaagac
tgtaagttcagtgacgactcggatgatgactttgtgcaaccccggaagaagcgcctcaag
agcatggaagaccggcagctgctcaagacctcaaccaatattgacctcaagtctttaggg
atctgtgaaacaattccaataagttcttatttaaaagaaaaagagcggcttaggcaacca
accgcagcacacagccagcccaggcgccacgaagtgtggagaaggaagcagagcggtgtg
cgcacgataaagaggggtgggcctgcagatgagaggctagtaatagctattgctgaagac
aacatacactttggacaagggcttggaggaactgagatggaatcgacctggaagcctcct
ccccgaggactaattctcacatctaatgattctcagcaagctgctaagagagaagagcaa
tcactagtcctacctagtggtaaagcacaaacccacaaccaccagcagcagggcaacatt
cccagtggtgcaacagtggcactgacatcagctgacgctgacgcctgtgtggtcattaaa
gatggtgttctcaacggatacaggtttgaattttacaaacacgttacatttatttatttc
tcatgtgtgcgtggctgtgaatgcattcatggtgcatgtggaggtcagaggataactcgc
agactcagaactgtccttctatcacgtagatctggggaactgaactcagactatcctgtt
tggcagcaagcgtcttctcccagcatttgtcacagtgacaagtttgaagaacaccctgat
tttataagaaagggaagagatcttgtctttgagagactggacttcagtagactgaacaag
agaggggaaatccacatcaaactctctggtatcatttccacaggacgttttaagaaactt
gtcaaatggttatcagcagtcagagacgcacaagctgaaagctcgcctggcacgtcccat
gcatccgcgccactccccaatgctcacctcagcagtgtaaatgtagatggtgttgaagtt
cgccgccaccagggccctcagcatgaagaggaagccaatgaggccggcactgaagaagaa
gcagaggaagttatagggacagacacagaggaccttccaggatggcctcataaagctctg
agccttggcaggctgctgttcctcaaccggcccaactgtggcatcctaagccagtttcct
cacaatccattcaccaaatag

DBGET integrated database retrieval system