KEGG   Rattus norvegicus (rat): 500116Help
Entry
500116            CDS       T01003                                 

Gene name
Tra2a, RGD1562563
Definition
(RefSeq) transformer 2 alpha homolog
  KO
K12897  transformer-2 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    500116 (Tra2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    500116 (Tra2a)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    500116 (Tra2a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     500116 (Tra2a)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   SR proteins
    500116 (Tra2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Apt1
Motif
Other DBs
NCBI-GeneID: 500116
NCBI-ProteinID: NP_001119768
RGD: 1562563
Ensembl: ENSRNOG00000009156
UniProt: B1WC25
Position
4q24
AA seq 282 aa AA seqDB search
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTCLG
VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANG
MELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtagaggagaacaacttcgagggcagagagtctcgctctcagtcaaaatct
ccaacgggaactcctgctcgtgtaaaatcagagagcaggtcaggatctcgtagtccatca
agggtttccaaacattctgaatcccattctcgatcaagatcaaaatccaggtcgaggtca
cggaggcattctcatagacgctacacgcgatccaggtcacactctcacagaagacggtcg
cgaagtaggtcctatacaccagagtacaggcggaggaggagccggagccactcccccatg
tcaaaccgcagaaggcacactggcagcagggcaaacccagatcctaacacttgcctggga
gtatttggcctcagtctgtatacaacagagagagatcttcgtgaagttttttctcgatat
ggacctctgagtggtgttaatgtggtttatgatcagcgaactgggaggtcacgcgggttt
gcttttgtgtattttgagaggatagatgactctaaggaggctatggaaagagcaaatggg
atggagctggatggtagaagaattcgtgtggattattctatcaccaagagagcacacaca
cctacaccaggcatttacatgggcagaccaactcacagtggtggtggaggtggcggagga
ggaggtggtggcggcggtggtggtggaggtggtagacggcgagattcttactacgataga
ggatatgatcgaggctatgacagatatgaagattatgattaccggtacagaagaaggtcg
ccttctccttactacagtcgctacaggtcacgatcaagatcccgttcctatagcccaaga
cgctattga

DBGET integrated database retrieval system