KEGG   Rattus norvegicus (rat): 500129
Entry
500129            CDS       T01003                                 

Gene name
Hoxa13, RGD1562483
Definition
(RefSeq) homeo box A13
  KO
K09298  homeobox protein HoxA/C/D13
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    500129 (Hoxa13)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    500129 (Hoxa13)
SSDB
Motif
Pfam: HoxA13_N Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 500129
NCBI-ProteinID: NP_001258284
RGD: 1562483
Ensembl: ENSRNOG00000053148
UniProt: A0A0G2K5C1
Position
4q24
AA seq 386 aa
MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAAAGAGGGGFPH
PAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPGAAAAYSSAPGEAPPTAAAAA
AAAAAAAAAAAAASSSGGPGPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYP
CARMGPHPNAIKSCAQPASAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHH
HQPVPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQTQPPHLW
KSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLS
ERQVTIWFQNRRVKEKKVINKLKTTS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgacagcctccgtgctcctccacccccgctggatcgagcccaccgtcatgtttctctac
gacaacggcggcggcctggtggccgacgagctcaacaagaacatggaaggggcggcggcg
gcggcagcggcggcggcagcggcagcggcggcgggagctgggggcgggggcttcccccac
ccggctgcggcggccgcggggggcaacttctcggtggccgcagcggctgccgccgccgcc
gccgccgcggccaaccagtgccgcaacctgatggcgcatcccgcaccactggcgccgggc
gccgcggccgcgtacagcagcgccccgggggaggcgcccccgaccgccgccgccgccgcc
gctgccgctgctgccgccgccgccgccgcggctgccgcgtcgtcgtcgggagggcccgga
ccggcggggcccgcgggtgccgaggccgccaagcagtgtagtccctgctcggcggcggca
caaagctcgtcgggtcccgcggcgctgccctatggctacttcggcagcggctactacccg
tgcgcccgcatgggcccgcaccccaacgccatcaagtcctgcgcgcagcctgcctcggct
gcggccgccttcgccgacaagtacatggacaccgccggccccgcggccgaggagttcagc
tcccgcgccaaggagtttgccttctaccaccagggctacgcagccgggccttaccaccac
caccagcccgtgcccggctatctggatatgccagtggttccggggctcgggggtcctggc
gagtcgcgccacgagcctctggggcttcctatggaaagctatcagccctgggctctgccc
aacggctggaacggccaaatgtactgccccaaagagcagacgcagcctccccacctctgg
aagtccactctgcccgacgtcgtctcccatccttcagacgccagctcctataggaggggg
agaaagaagcgggtgccttacactaaggtgcagttgaaagaactcgaacgggaatacgct
acgaacaaattcattaccaaggacaaacggaggaggatatcagccacaacgaacctctct
gagaggcaggtcacaatctggttccagaacaggagggtcaaagagaaaaaagtcatcaat
aaactcaagaccacgagttaa

DBGET integrated database retrieval system