KEGG   Rattus norvegicus (rat): 500156
Entry
500156            CDS       T01003                                 

Gene name
Atoh1, RGD1565171
Definition
(RefSeq) atonal bHLH transcription factor 1
  KO
K09083  atonal protein 1/7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    500156 (Atoh1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    500156 (Atoh1)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 500156
NCBI-ProteinID: NP_001102708
RGD: 1565171
Ensembl: ENSRNOG00000006383
UniProt: D3ZQL9
Position
4q31
AA seq 351 aa
MSRLLHAEEWAEVKELGDHHRHPQPHHIPQLTPQPPATLQARDHPVYPAELSLLDSTDPR
AWLTPTLQGLCTARAAQYLLHSPELGASEAAAPGDEADGQGELVRRSGCGGLSKSPGPVK
VREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLR
NVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSVGEQPPPPAASCKNDHHHLRAAAS
YEGGAGASAVAGAQPAPGGGPRPTPPGACRTRFSTPASSGGYSVQLDALHFPAFEDRALT
AMMAQKDLSPSLPGGILQPVPEDSSKTSPRSHRSDGEFSPHSHYSDSDEAS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtcccgcctgctgcatgcagaagagtgggctgaggtaaaagagttgggggaccaccat
cgccatccccagccgcaccacatccctcagctgacgccacagccacctgctaccctacag
gcgagagaccatccggtctacccggcagaactgtccctcctggatagcaccgacccacgc
gcctggctgactcccactttgcagggcctctgcacggcacgcgccgcccagtatctgctg
cattctcccgagctgggtgcctccgaggccgcggcgcccggggacgaggctgacggccag
ggtgagctggtaaggagaagcggctgcggcggcctcagcaagagccccgggccggtgaaa
gtgcgggaacaactgtgcaagctgaagggcggggttgtagtagacgagctgggctgcagc
cgccagcgagccccttccagcaaacaggtgaatggggtacagaagcaaaggcgactggca
gcaaacgcaagggagcggcgcaggatgcacgggctgaaccacgccttcgaccagctgcgc
aacgttatcccgtccttcaacaacgacaagaagctgtccaaatatgagaccctgcagatg
gcccagatctacatcaacgccctgtcggagttgctgcagactcccagtgtcggagagcag
ccaccgccgccagcagcctcctgcaaaaatgaccaccatcaccttcgcgcagccgcctct
tatgaaggaggagcaggcgcctctgcggtagctggggctcagccagccccgggagggggc
ccgagacccaccccgcctggagcttgccggactcgcttctccaccccagcttcctccggg
ggttattcagtgcagctggacgctttgcactttccagctttcgaggaccgggccctaaca
gcgatgatggcacagaaggacctgtcgccttcgctgcccgggggcatcctgcagccagta
ccggaggacagcagcaaaacatctcccaggtcccacagaagtgacggagagttttccccc
cactctcattacagtgactctgacgaggccagttag

DBGET integrated database retrieval system