KEGG   Rattus norvegicus (rat): 500235
Entry
500235            CDS       T01003                                 

Gene name
Emx1, RGD1564002
Definition
(RefSeq) empty spiracles homeobox 1
  KO
K09317  homeobox protein EMX
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    500235 (Emx1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Ems
    500235 (Emx1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 500235
NCBI-ProteinID: XP_001073769
RGD: 1564002
Ensembl: ENSRNOG00000015493
UniProt: D3ZV90
Position
4q34
AA seq 290 aa
MCQAWCTPRTAAAPGHRAFPRAPLPHSSSAAATMFQPATKRGFTIESLVAKDGGTGGSPG
SGGAGSHPLAVAASEEPLRPTALNYPHPSAAETAFVSGFPAAAAAGASRSLYGGPELVFP
EAMNHPALTVHPAHQLGSSSLQPPHSFFSAQHRDPLHFYPWVLRNRFFGHRFQASEVPQD
GLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWF
QNRRTKYKRQKLEEEGPESEQKKKGSHHINRWRIATKQANGEDIDVTSND
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtgccaggcttggtgcacaccccgcacggcggcagcgccggggcaccgagcgttcccc
agagccccactacctcactcctcttcggcggcagcgaccatgttccagcccgcgactaag
cggggtttcaccatagagtccttggtagccaaggatggtggcaccggcgggagtcctggc
agcgggggcgcgggctcccatcccctggctgtggccgcctcagaagaaccgctcaggccc
acggcgctcaactaccctcaccccagtgcagccgagacggccttcgtgagtggcttccct
gccgctgcagctgcgggcgccagccgctcgctctacggagggccggagctggtgttccca
gaggccatgaaccacccggctctgacggtgcacccggcacaccagctgggctcctcctcg
ttgcaaccccctcactctttcttcagcgcccagcatcgggaccctcttcacttctacccc
tgggtgcttcggaatcgcttctttggtcaccgcttccaggcaagcgaagttccccaggac
gggctgcttttgcacgggcccttcgcgcgcaagcccaagcggattcgcacggccttctcg
ccctcgcagctgctgcggctggagcgagcctttgagaagaatcactacgtggtgggtgcc
gagcggaagcagctggcaggcagcctcagcctctccgagacgcaggtgaaggtgtggttc
cagaatcggaggacaaaatacaaacggcagaagctggaggaggaagggccggagtctgag
cagaagaagaagggttcccaccatatcaaccggtggcgcatcgccacgaagcaggccaac
ggggaggacattgatgtcacctctaatgactag

DBGET integrated database retrieval system