KEGG   Rattus norvegicus (rat): 500244
Entry
500244            CDS       T01003                                 

Gene name
Aak1, RGD1563580
Definition
(RefSeq) AP2 associated kinase 1
  KO
K08853  AP2-associated kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    500244 (Aak1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    500244 (Aak1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     500244 (Aak1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  NAK family [OT]
   500244 (Aak1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    500244 (Aak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 500244
NCBI-ProteinID: NP_001166921
RGD: 1305520
Ensembl: ENSRNOG00000018317
UniProt: F1LRI7
Position
4q34
AA seq 963 aa
MKKFFDSRREQGSSGLGSGSSGGGGSSSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFALV
FLVRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVW
EVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVE
NILLHDRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIIT
TKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPDNSRYSQDMHCLIRYMLEPDPDK
RPDIYQVSYFSFKLLKKECPVPNVQNSPIPTKLPEPVKASEAAVKKTQPKARLTDPIPTT
ETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPLPQATGPSNQPSLLASVSQPKA
QATPSQPLQSSQPKQPQAPPTPQQTPAPQTQGLPTQAQATPQHQQQLLLKQQQQQQQQQQ
QQQPQQPTAPPQPSGTFYQQQQPQQQQAQTQQFQAVHPAAQQSVTAQFPVVSQGGSQQQL
MQNFYQQQQQQQQQQQQLMAQQAALQQKTAVVVPQPQAQPATAPQAAAAQEPAQIQAPAR
QQPKVQTTPPPTIQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLHA
AAAEASLSKSKSATTTPSGSPRTSQQNVSNASEGSTWNPFDDDNFSKLTAEELLNKDFAK
LGEGKLPEKLGGSAESLIPGFQATQGDAFATSSFSAGTAEKRKGGQAVDSGIPLLSVSDP
FIPLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADAAVESLIPGLEP
PVAQRLPSHTESVTSNRTDSLTGEDSLLDCSLLSNPTADLLDEFAPIALSASTHKAAEDS
NLISGFGVAEGSEKVAEDEFDPIPVLITKNTQGGHSRNSSGSSESSLPNLARSLLLVDQL
IDL
NT seq 2892 nt   +upstreamnt  +downstreamnt
atgaagaagtttttcgactccaggcgggagcaggggagctctggcctgggttcgggctcc
agcggaggagggggcagcagctcaggcctgggcagtggctacatcgggagggtcttcggc
atcgggaggcagcaagtcaccgtggacgaggtcttggcagaaggtggattcgctctcgtc
tttctggtgagaacaagcaatggggtgaaatgtgccttgaaacgcatgtttgtcaacaat
gagcatgaccttcaggtgtgcaagagggagatccagatcatgagggacctatcagggcac
aagaacattgtgggctacattgattctagtatcaacaatgtgagcagtggcgacgtatgg
gaagttctcattctcatggacttctgcagaggaggccaggtggtaaacctgatgaaccag
cgtctccagacaggctttacagagaatgaagtgctgcagatcttctgtgacacctgtgag
gctgtggcccgcctgcatcagtgcaaaactcccattatccaccgggacctgaaggttgaa
aatatcctcttgcatgaccgaggccactatgtcttgtgtgactttggaagtgccaccaac
aaattccagaatccacaggccgagggagtcaatgcagtagaagatgagattaagaaatac
acaacgctctcctatcgagccccagaaatggtcaacttgtacagtggcaaaatcatcacc
acgaaggcagatatttgggctcttggctgtttgttgtataaattatgctacttcactttg
ccatttggggagagccaggtggcaatttgtgatggaagcttcacaattcctgataactct
cgatattcacaagatatgcactgccttattaggtatatgttggaaccagaccctgacaaa
aggccggatatttaccaggtttcttacttctcatttaaactactcaagaaagaatgccca
gttccaaatgtacagaattctcccattcctacaaaacttcctgaaccagtgaaagccagt
gaggcagctgtaaaaaagacccagccaaaggccagactgacagatcccattcccaccaca
gagacttcaattgcaccccgccagaggcctaaagctgggcagactcagccaaaccccgga
atccttcccattcagccagccctgactcctcgtaagagggccactgttcagcccctacct
caggctacaggacccagcaatcagcctagccttctagccagtgtttcccagcctaaagcc
caagccacgcccagtcaacctcttcagtcatctcaacccaagcagccacaagctccaccc
accccacagcagacgcctgctccccagacccagggtctgcccacccaggcccaggctact
cctcagcaccagcagcagctcctcctcaagcagcagcagcagcagcaacagcagcagcag
cagcaacagccacagcagccaacagcaccaccacagccatcaggcaccttttaccagcag
cagcagccccagcagcagcaggctcagactcagcagtttcaggcagtgcatccagcagcc
cagcaatcagtcactgctcagttccctgtggtgtcccagggaggctctcagcaacagctg
atgcagaacttctaccagcagcagcagcagcagcaacagcagcagcaacagctgatggct
cagcaggccgccctgcagcagaagactgctgtggtagtaccacagcctcaggcacagcca
gccacagccccacaggcagctgctgcccaggagcctgcgcagattcaagccccagcaaga
caacagccaaaagttcagaccactccacctccaaccatccagggacagaaagttggctct
ctcactcctccatcatctccgaaaacccaacgtgctgggcacaggcggattctcagtgat
gtaacccacagtgcagtcttcggggttcctgccagcaagtcaacccagctgctccacgcg
gctgcagctgaggccagtctcagtaaatctaagtctgcaaccaccactccttcaggctct
ccacggacttcccagcagaatgtctctaatgcttccgaaggctccacatggaatcctttt
gatgatgacaacttctccaaactcacggctgaagagctgctgaacaaggatttcgcgaag
cttggggaaggaaagcttcctgagaagcttggaggctctgcagagagtttgatcccaggt
ttccaggcaacacaaggagatgcctttgccacttcctccttttctgctggaaccgctgag
aagagaaaggggggacaggctgtggattctggcatcccacttctaagtgtgtctgatcct
ttcattcctcttcaggtacctgatgctccagaaaaactaatcgagggactcaaatctcct
gacacttctcttctgctccctgacctcttgcctatgacagatccttttggcagcacttcc
gatgctgtgattgaaaaagctgatgctgctgttgagagtctcatacctgggctggagcca
cctgttgcccagcgcctcccatctcacacggaatctgtgacttcaaaccgcacagactct
ctcacgggggaagactctctccttgactgttctctgctttctaaccctactgctgacctt
ctggacgagtttgcccccatagcactctctgcttccactcataaagctgcagaagatagt
aatctcatctcagggtttggtgtcgctgagggctccgaaaaggtggcagaagatgagttt
gaccctattcctgtactgataaccaaaaacacacaaggtgggcactctaggaacagcagt
gggagctctgagtccagtcttcccaacctagccaggtctttgctgctggtggatcagctc
atagacctgtag

DBGET integrated database retrieval system