KEGG   Rattus norvegicus (rat): 500245
Entry
500245            CDS       T01003                                 

Gene name
Bmp10
Definition
(RefSeq) bone morphogenetic protein 10
  KO
K22670  bone morphogenetic protein 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    500245 (Bmp10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    500245 (Bmp10)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   500245 (Bmp10)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 500245
NCBI-ProteinID: NP_001026994
RGD: 1562986
Ensembl: ENSRNOG00000009316
UniProt: Q4AEG6
Position
4q34
AA seq 421 aa
MGSLVLPLSAVFCLVARLASGSPIMGLEQSPLEEDMPFFDDIFTEQDGIDFNTLLQSMKD
EFLKTLNLSDIPPQDTGRVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSF
NGIRKYPLLFNVSIPHHEEVVMAELRLYTLVQRDRLMYDGVDRKIIIFEVLESADGSEDE
RSMLVLVSTEIYGTNSEWETFDITDATRRWQKSGPSTHQLEIHIESRQNQAEDTGRGQLE
IDMSAQNKHDPLLVVFSDDQSGDKEQKEELNELISHEQDLDLGTDGFFGGPDEEALLQMR
SNMIDDSTARIRRNAKGNYCKKTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEH
LTPTKHAIIQALVHLKNSQKASKACCVPTKLDPISILYLDKGVVTYKFKYEGMAVSECGC
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgggttctctggttctgccgctgagcgccgtcttctgcctggtggctcgtctggcttct
ggcagccccatcatgggccttgagcagtcgcccctggaagaagacatgcccttctttgat
gatatcttcacagaacaagatggtattgacttcaacacactgctgcagagcatgaaggac
gagtttctcaagacgttgaatctgtcagacattcccccacaggacacaggcagagtggat
ccgccggagtacatgctggagctctacaacaaattcgccacggaccggacctccatgcca
tctgctaacatcatccggagcttcaagaatgaagatctgttttctcaaccagtcagtttc
aatgggatccggaagtatcctctcctcttcaacgtgtccatccctcaccacgaagaggtc
gtcatggctgaactgaggttgtacacgctggtgcagagagatcgtttgatgtatgatggt
gtggaccgtaaaataatcatctttgaggttctagagagtgccgatggtagcgaggatgag
aggagcatgctggtcttggtatcaacggagatctacggaaccaacagtgagtgggagaca
tttgacatcacggatgccaccagacgttggcaaaagtcaggcccatcaacccaccagctg
gagatccacatcgaaagcagacaaaaccaagctgaggacaccggaaggggacaactggaa
atagatatgagtgctcagaataagcacgaccctttgcttgttgtgttttctgatgaccaa
agcggtgacaaggagcagaaagaagagctgaatgaactgatctcccacgagcaggatctg
gacctgggcaccgatggtttctttggtgggcctgatgaagaggctctcctgcagatgagg
tcaaacatgatcgatgactctaccgctcggatcaggaggaacgccaaggggaactactgc
aagaagactccactgtacatcgacttcaaggagatcggctgggactcctggatcatcgcg
cctcctggttacgaggcctatgagtgccgcggtgtgtgcaactaccctctggcggagcac
ctcacacctacgaaacacgcaattatccaggccttggtccacctcaagaattcccagaaa
gcctccaaagcctgctgcgtgcccacgaagctggatcccatctccatcctctatttagat
aaaggtgttgtcacctataagtttaaatacgaaggaatggccgtgtctgaatgtggctgt
agatag

DBGET integrated database retrieval system