KEGG   Rattus norvegicus (rat): 500287Help
Entry
500287            CDS       T01003                                 

Gene name
Srgap3, RGD1563152
Definition
(RefSeq) SLIT-ROBO Rho GTPase activating protein 3
  KO
K07526  SLIT-ROBO Rho GTPase activating protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    500287 (Srgap3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    500287 (Srgap3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    500287 (Srgap3)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    500287 (Srgap3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP FCH SH3_1 SH3_2 SH3_9 Adhesin_P1_N Flg_hook
Motif
Other DBs
NCBI-GeneID: 500287
NCBI-ProteinID: NP_001178904
RGD: 1563152
Ensembl: ENSRNOG00000006509
UniProt: F1M5M9
Position
4q42
AA seq 1099 aa AA seqDB search
MSSQTKFKKDKEIIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIE
LEYSRSLEKLAERFSSKIRSSREHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIF
MNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESK
LKEAEKQEEKQFNKSGDLSMNLLRHEDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKAR
NDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLD
IIENAVDNLDSRSDKHTVMDMCSQVFCPPLKFEFQPHMGDEVCQVSAQQPVQTELLMRYH
QLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESIKSAASETYM
SKINIAKRRANQQETEMFYFTKFKEYVNGSNLITKLQAKHDLLKQTLGEGERAECGTTRP
PCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVVESCIRFINLYGLQQQGI
FRVPGSQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDL
ISTIKLENPADRVHPIQQILITLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMHIPDGQDPVSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEYCDSPH
SEPGTIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASED
WWEGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTE
HISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIP
LSRGRIESPEKRRMATFGSAGSINYPDKKALTEGLSMRSTCGSTRHSSLGDHKSLEAEAL
AEDIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPGPISSEPASPLHTIVIRD
PDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRSSSSSSSGVGSPA
VTPTEKMFPNSSSDKSGTM
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcaaactaagttcaagaaagacaaagagatcattgctgaatatgaagcccaa
ataaaagagatccgcacgcagctggtggagcagttcaaatgcctggagcagcagtcagag
tcgcggctgcagctgctgcaagacttgcaggagttcttccgcaggaaagctgagatcgag
ctggagtattcccgcagcctggagaagctggccgagcgcttctcctccaagattcgaagc
tcccgggagcaccagttcaagaaggatcaatacctcctctcacctgtgaactgttggtat
ctggtactgcatcagactcggcgggagagccgagatcacgccaccctcaatgacatcttc
atgaacaatgtcatcgtccgcctctcccagatcagtgaagatgtcatcagactcttcaaa
aagagcaaagagattggcctgcagatgcatgaggagctgctgaaggtgaccaatgagctc
tacacagtcatgaaaacctaccacatgtaccatgcagagagcatcagtgcagaaagcaag
ctgaaggaggccgagaagcaggaggagaaacagtttaacaagtcaggagacctgagcatg
aaccttctccggcacgaggacagaccccagcgccgcagctccgtgaagaagattgagaag
atgaaggagaagaggcaggccaagtattctgagaacaagctcaagtgcacaaaggcccga
aatgactacctgctgaatctggcagccaccaacgcagctatcagcaaatactacatccac
gatgtctctgatctcatcgattgctgtgatttgggctttcacgccagcctggcccgcacc
tttcggacctacctctcagcagaatataacctggagacctctcgccacgagggcctggac
atcatagagaatgcagtggacaacctggactcccggagtgacaagcacacagtcatggac
atgtgcagccaggtcttctgccctccactcaagtttgagttccagccccacatgggggat
gaggtctgccaggtcagtgcacagcagcctgtccagacggagctgcttatgcggtaccac
cagctgcagtccaggctggccactctcaagattgagaacgaagaggttaggaaaaccctg
gatgccaccatgcagaccttacaggacatgctgaccgtggaggactttgatgtctctgac
gccttccaacacagccgatctacagagtccataaagtcagctgcttctgagacctacatg
agcaaaatcaacatcgccaaaaggagagccaaccagcaggagacagaaatgttttatttt
acaaaatttaaagaatatgtgaatggcagtaacctcatcaccaagctgcaagccaagcat
gacttactcaagcagaccctgggtgaaggggagagagcagagtgcggcacaaccaggccc
ccctgtcttccccctaaaccacagaaaatgaggagacctaggcctctttcagtgtatagc
cataaactctttaacggcagtatggaagcgttcattaaggattcaggacaagctatacca
cttgtagtcgagagctgtattcgattcatcaatttatatggactccagcagcaggggatc
ttcagagttccagggtctcaggttgaagtcaatgacatcaagaattcctttgagagaggt
gaagaccccctcgtggatgaccaaaatgagcgagatatcaattcagttgctggtgtttta
aaactgtatttccgaggactggaaaacccactctttcctaaggaaaggtttcaagatttg
atatctactattaaactggagaacccagctgacagggtgcacccaatccagcagatcctc
atcaccctgccccgcgtggtcattgtggtcatgagatacctctttgctttcctcaatcac
ctttcccagtacagtgatgagaacatgatggatccctacaacttggccatctgcttcggg
cccaccctcatgcacatccctgatgggcaggaccctgtatcctgccaggcacatgtcaat
gaagtcatcaaaaccatcatcatccaccatgaagccatcttccccagcccgagggagcta
gagggacccgtatacgaaaaatgcatggctggaggggaagagtactgtgacagcccacac
agtgagccggggaccattgatgaagttgaccatgacaatggcacggagcctcataccagc
gatgaagaagtggaacagatcgaggccatcgccaagtttgactatgtggggcggtcccct
cgtgaactatctttcaaaaaaggggcctcactactcctgtaccaccgtgcctccgaggac
tggtgggagggccgtcacaatggcgtagatggactcatccctcatcagtacatagttgta
caggacatggatgatgccttctccgatagcctgagccaaaaggctgacagcgaggccagc
agtgggccactgctggatgacaaggcctcctccaagaatgacctccagtcccccacagag
cacatctctgattacggctttgggggggtgatgggccgagtgagactacggtccgacgga
gcagccatccccaggcgccgaagtgggggcgacacacacagcccaccccggggcttgggt
cccagcatagatacgccaccccgagctgctgcctgtcccagcagcccccacaaaatcccc
ctcagccggggacggattgagagccctgagaagaggaggatggcgacgttcggaagcgct
ggcagcatcaactaccctgacaagaaggcgctgacagaagggctctccatgaggtcaact
tgcggctccactcgacacagcagcctaggggaccacaagtccctagaggctgaggccctc
gcagaagacatcgagaagaccatgagcacggctcttcatgagttgcgggaacttgagaga
cagaacactgtcaagcaggcaccagatgtggtgctggacaccctggagcccctaaagaat
ccaccaggccccatcagctcagagcctgccagccccctgcacaccattgtcatccgagac
cccgatgctgccatgcgtcgaagcagcagctcgtctacagagatgatgaccaccttcaag
ccagccctgtcggctcgcctggctggtgcccagctgcgtccaccccccatgcgtccagtc
agacctgtggtccagcaccggtccagcagcagcagcagctcaggtgtgggcagcccggca
gtgacacctaccgagaagatgttccctaatagctcctcagacaagtccggcactatgtga

DBGET integrated database retrieval system