KEGG   Rattus norvegicus (rat): 500288Help
Entry
500288            CDS       T01003                                 

Gene name
Thumpd3, RGD1560852
Definition
(RefSeq) THUMP domain containing 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0020 THUMP AviRa Methyltransf_25 Methyltransf_11 MTS
Motif
Other DBs
NCBI-GeneID: 500288
NCBI-ProteinID: NP_001164017
RGD: 1560852
Ensembl: ENSRNOG00000006941
UniProt: D3ZSV7
Position
4q42
AA seq 504 aa AA seqDB search
MSDTQEATREHLDMNLHENKKPVPLIESGIRSESEHLQVTIGATVPTGFEQTAADEVREK
LKSSCRISKDRGKIYFDIAVESLAQVHCLRSVDNLFVVVEEFKDYQFKATKEEVLRDFEE
LAGKLPWSDPLKVWQINTTFKKKKAKRRKANQSAGREKADCGQGDNAGEKDGKKKLASGA
ADPHILDYYENPAIKEEISTLIGEVLASGEDENGQSLREEAEPQVQKFRVTCNRAGEKHC
FTSNEAARGFGGAVQEYFKWKADMTNFDVEVLLNIHNNEVIVAIALTEESLHRRNITHFG
PTTLRSTLAYGMLRLCEPKPTDVIVDPMCGTGAIPIEGATEWSHCYHIAGDNNPLAVNRA
ANNISSLLTKSQIKDGKTSWGLPIDAVQWDICNLPLRTASVDIIVTDMPFGKRMGSKKRN
WNLYPACLREMSRVCRPRTGRAVLLTQDKKCFTKALSGMGHVWRKVHTVWVNIGGLHAAV
YLLKRTPQDFVHPSDQDGGKDPPW
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacactcaagaagctaccagagaacacttggatatgaaccttcatgagaacaag
aagccggtgcccttgatagaaagtggcatcagaagtgagtctgagcatctccaagtcacc
attggagccactgtacctactgggtttgagcaaacagctgcagatgaagtgagagagaaa
ttgaagtcatcctgcagaatcagcaaagaccggggcaagatatattttgatattgcagtg
gaaagtctggctcaggttcattgtctgagatcagtggataacttgtttgtggttgttgag
gagtttaaagattaccagttcaaagctacaaaggaagaagttctaagagactttgaagaa
ctggctggaaaactcccatggtcggaccctttaaaagtctggcaaattaacaccactttc
aagaagaagaaggcaaagcgcagaaaggccaatcagagtgcaggcagagagaaggccgac
tgtggacagggcgacaatgccggtgagaaggacggtaagaagaagcttgccagtggtgcg
gcagatccacatatcttagactactatgaaaatccagccatcaaagaagagatatcaacc
ttaataggggaagtcttggcatctggcgaagatgaaaacggtcaaagcttaagagaagaa
gctgaaccgcaagtgcagaagttcagagtcacctgcaacagagcaggagagaagcattgc
tttacatccaacgaggctgccagaggttttggaggtgctgttcaagagtactttaagtgg
aaggctgatatgaccaactttgacgtagaggttctcctgaacatccacaataatgaagtc
attgttgctattgcactgacagaggagagtctccatcgcagaaatattacacattttgga
cctacaactcttaggtcaactcttgcctatgggatgctcaggctctgtgaacctaaacct
actgatgtaattgtagatccaatgtgtggaacaggggcaataccaatagagggggctact
gagtggtctcactgttaccatattgctggggacaacaacccactggcagtgaacagagca
gcaaataacatctcatctctattgactaagagccagattaaagatggaaaaacatcctgg
ggtttgcccattgatgctgttcagtgggatatctgcaacctccctctgcgaactgcttct
gtggatattattgtaacagacatgccatttggaaaaaggatgggctccaaaaagagaaat
tggaatctctatccagcttgccttcgggaaatgagccgtgtctgtagaccaaggacaggt
agagctgtactgcttactcaggacaagaaatgttttaccaaggcattatctggaatggga
catgtgtggcgaaaggtccatacagtctgggtgaacatcgggggccttcatgctgcagtt
tatcttctaaaacgcactcctcaagactttgttcatccttcagatcaagatggaggaaaa
gaccctccttggtaa

DBGET integrated database retrieval system