KEGG   Rattus norvegicus (rat): 500305
Entry
500305            CDS       T01003                                 

Gene name
Dcp1b, RGD1562214
Definition
(RefSeq) decapping mRNA 1B
  KO
K12611  mRNA-decapping enzyme 1B [EC:3.-.-.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    500305 (Dcp1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    500305 (Dcp1b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     500305 (Dcp1b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     500305 (Dcp1b)
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     500305 (Dcp1b)
SSDB
Motif
Pfam: DCP1 mRNA_decap_C WH1
Other DBs
NCBI-GeneID: 500305
NCBI-ProteinID: XP_001057512
RGD: 1562214
Ensembl: ENSRNOG00000007340
UniProt: D3ZZJ7
Position
4q42
AA seq 582 aa
MAAAAAGGLPGKGHDISLAALRRHDPYINRIVDVASQVALYTFGHRANEWEKTGVEGTLF
VYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNGTLSIYGIWFYDKEEC
QRIAKLMKNLTQCEQLKACHGAGAGSSPVTLSSGEGREVDILQMLTKAKDEYTKCRSCSE
PKQMTSSSAICDNPKLIKPVPVRPSSSQRLHEPTPSKTLDPEPQHLPLTALFGKQDKAPC
QETVKPSRTFAHHHHHHHHHQQQEKLPVHHGVACSLACEDPRKLSLPVEKQLCPAIQKLM
VGSMGLHSLPQHPGQWPCESGSPSPAGGILPGPVQLGAPWNGRAAHCTQSTCRSHKLLEQ
LQGAPAAVHKYSFCAPASPAVTTQVAPGQSVAQSQLVYFSGPLPPPTPGHQALGKEQCAP
PAQAVSLSGSQESSPTVLPTQELLRKLQVVQQEQQAAPRPALAARFPVSAQGSGTEKPLE
AWVSKTASMEKQAPLLQSTCAPLRETDNGLMALGGPELPAASSSLLLPLQNWESSTMASR
PLTRLQLQEALLNLIQNDDNFLSIIYEAYLFSVTQAAMRKAT
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggcggccgcggcggcaggtggcctgcctgggaagggacacgatatcagcctggcagcc
ctgcggcgccacgacccctacatcaatcgcatcgtggacgttgccagccaggtggctctg
tacactttcggccatcgggccaacgagtgggagaagactggtgtggaaggaaccttattt
gtttatacaaggtctgcctctccgaagcacggattcaccattatgaataggctcagcatg
gaaaacagaacagagcccattactaaagacttggacttccagctccaggaccctttcctt
ctctacagaaatggcacactgtccatttatggaatttggttttatgataaggaagagtgc
cagagaattgcaaaactaatgaaaaacctcactcagtgtgaacagttgaaagcctgtcat
ggagctggagcaggatcctccccagtgaccttgagttcaggagagggccgagaagtagat
atcctgcagatgctcaccaaggccaaagatgagtacaccaagtgtaggagctgttctgag
ccaaagcagatgaccagttcttctgccatctgtgacaaccccaagctcatcaaacctgtc
cccgtgagacccagcagcagccagaggctgcacgaacccacgcccagcaagaccttggac
cctgagcctcaacacttacctttgacagcgctatttgggaaacaagacaaagccccttgt
caggaaactgtgaaaccatcccggacctttgcccaccaccatcaccatcaccaccaccac
cagcagcaagagaagcttccagttcatcacggggttgcatgctccctggcctgtgaggat
cccaggaagctctcactcccagtggagaagcagctatgcccagccattcagaaactcatg
gttgggagcatggggctgcactccctgccacagcaccctggacagtggccctgtgaaagt
ggcagccccagccctgcagggggaattcttcctggtcctgtccagctgggggccccctgg
aatggtagggctgcacactgtacacagagcacttgcagaagccacaagctgttagagcag
cttcaaggtgcccctgccgcagtacataagtatagcttctgtgcacctgccagtccagcc
gtgaccactcaggtggctccaggccagagtgtggcccagtcacagctggtgtatttcagt
ggcccccttccacctcccacgccaggacatcaggctctcgggaaggagcagtgtgcacca
ccagcacaagcggtgtcgctctctggcagccaggagagcagccccactgtgctccctact
caggagctgctaagaaagctccaggtagtacaacaggagcagcaggcagccccccggcca
gccttggcagccaggttccctgtgtcagcccagggatcagggacagaaaagcccttggaa
gcctgggtcagcaagacagccagcatggagaaacaggctcctcttctgcagtctacctgt
gccccactgagagagactgataatgggctcatggccctaggaggcccagaacttcctgct
gcctcctccagcctccttctgcccctgcagaactgggaatcctccaccatggccagcagg
cccctcaccaggctgcagctccaggaggcactgctgaacctcatccagaatgacgacaac
ttcttaagcataatctacgaagcctatctcttcagcgtgacacaagccgccatgagaaaa
gccacgtga

DBGET integrated database retrieval system